Protein Family IF00606

Metagenome Isolate
135 Members
42 Samples
119 Scaffolds
269.73 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10001685|JGI24695J34938_1000168514
Length
270 aa
Sequence
MKSSKEVQIDNKLIEMVEAYNLSGSALKGLKLLLENKEIQALQEFANKVSISRLGYNDHGPVHMRTVTQSAILMMDLLRSAGIKTTIETDNCGNFEDSLLAVMLSSMLHDIGMSMGRQNHELHSTILACPIIDSILSEVYESLHKRVVVRSVALEGIAGHMGTISVSSLEAGIVQIADGLDMTKGRARIPIAMAHPPRVGHIHQYSANSIEDVCIKAGTEKPWRIDVYMSSEVGLFQVEEVLLHKIAGSSAKQHIELYATVDSNERQYL*

📊 Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.5%
Termitidae 42.5%
Kalotermitidae 7.5%
Termopsidae 5.0%
Rhinotermitidae 2.5%

🌳 Taxonomy

Archaea 2
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
14 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
24 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
25 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
26 650716102 Treponema primitia ZAS-2 Isolate Unclassified
27 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
28 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
29 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
36 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
40 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
41 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_017409 3300042614 Unclassified 2374
2 Ga0466715_483358 3300042616 Bacteria 2795
3 Ga0466735_072389 3300042624 Bacteria 1708
4 Ga0123356_10000198 3300010049 Bacteria 69577
5 Ga0123356_10022970 3300010049 Bacteria 5879
6 JGI24698J34947_10074469 3300002449 Bacteria 1617
7 JGI24699J35502_11055749 3300002509 Unclassified 1691
8 Ga0072941_1006666 3300005201 Bacteria 12856
9 Ga0072941_1025484 3300005201 Bacteria 7406
10 Ga0415639_021217 3300038395 Bacteria 2896
11 Ga0466712_017908 3300042614 Bacteria 4207
12 Ga0123356_10038221 3300010049 Bacteria 4473
13 Ga0466719_252540 3300042606 Bacteria 1405
14 JGI24698J34947_10038191 3300002449 Bacteria 2491
15 JGI24695J34938_10000012 3300002450 Bacteria 126955
16 JGI24695J34938_10004209 3300002450 Bacteria 9567
17 JGI24695J34938_10004689 3300002450 Bacteria 8863
18 JGI24695J34938_10010548 3300002450 Bacteria 5047
19 JGI24695J34938_10014501 3300002450 Bacteria 4083
20 JGI24695J34938_10028196 3300002450 Bacteria 2642
21 JGI24695J34938_10044570 3300002450 Bacteria 1972
22 Ga0072941_1002074 3300005201 Bacteria 7106
23 Ga0072941_1035456 3300005201 Bacteria 2825
24 Ga0466712_141030 3300042614 Bacteria 21264
25 Ga0123356_10075079 3300010049 Bacteria 3184
26 Ga0466707_064846 3300042601 Bacteria 1442
27 Ga0466707_289329 3300042601 Bacteria 1211
28 JGI24695J34938_10001208 3300002450 Bacteria 22898
29 Ga0072941_1005325 3300005201 Bacteria 19676
30 Ga0415639_089688 3300038395 Bacteria 2695
31 Ga0466693_351063 3300042592 Bacteria 21220
32 Ga0466694_093217 3300042594 Bacteria 19437
33 Ga0466694_121022 3300042594 Archaea 2706
34 Ga0466694_143224 3300042594 Bacteria 7681
35 Ga0466699_122886 3300042597 Bacteria 2199
36 Ga0466712_054156 3300042614 Bacteria 7617
37 Ga0466712_126245 3300042614 Bacteria 32754
38 Ga0466712_127052 3300042614 Bacteria 8199
39 Ga0466712_179083 3300042614 Bacteria 6745
40 Ga0466712_307627 3300042614 Bacteria 5152
41 Ga0466731_042172 3300042622 Bacteria 7303
42 JGI24698J34947_10010252 3300002449 Bacteria 5138
43 JGI24698J34947_10052689 3300002449 Bacteria 2041
44 JGI24695J34938_10065799 3300002450 Bacteria 1530
45 Ga0072941_1000592 3300005201 Bacteria 4054
46 Ga0466693_328248 3300042592 Bacteria 1584
47 Ga0466694_195315 3300042594 Bacteria 5435
48 Ga0466694_281195 3300042594 Unclassified 2677
49 Ga0466699_013823 3300042597 Bacteria 2370
50 Ga0466699_116490 3300042597 Bacteria 4215
51 Ga0466699_331534 3300042597 Bacteria 1590
52 Ga0466712_080626 3300042614 Bacteria 8129
53 Ga0466715_126672 3300042616 Unclassified 1251
54 Ga0466718_118754 3300042617 Bacteria 2933
55 Ga0466729_115975 3300042621 Bacteria 5014
56 Ga0466731_130836 3300042622 Bacteria 3382
57 Ga0123356_10198305 3300010049 Bacteria 2045
58 Ga0466707_361161 3300042601 Bacteria 2493
59 Ga0466720_202236 3300042607 Bacteria 5962
60 JGI24695J34938_10000016 3300002450 Bacteria 116336
61 JGI24695J34938_10000392 3300002450 Bacteria 43117
62 JGI24695J34938_10000712 3300002450 Bacteria 31375
63 JGI24695J34938_10001776 3300002450 Bacteria 17795
64 JGI24695J34938_10003913 3300002450 Bacteria 10069
65 JGI24695J34938_10016820 3300002450 Bacteria 3708
66 JGI24695J34938_10041133 3300002450 Bacteria 2077
67 JGI24695J34938_10090215 3300002450 Unclassified 1258
68 Ga0072941_1001014 3300005201 Bacteria 35346
69 Ga0072941_1002784 3300005201 Bacteria 7855
70 Ga0072941_1008601 3300005201 Bacteria 8274
71 Ga0072941_1087711 3300005201 Bacteria 2875
72 Ga0415639_026827 3300038395 Unclassified 3543
73 Ga0415639_089687 3300038395 Bacteria 4337
74 Ga0415639_143942 3300038395 Bacteria 1658
75 Ga0466712_029782 3300042614 Bacteria 10297
76 Ga0466715_089588 3300042616 Bacteria 12147
77 Ga0466726_362903 3300042619 Bacteria 1608
78 Ga0123356_10010822 3300010049 Bacteria 8921
79 Ga0123356_10277722 3300010049 Bacteria 1769
80 JGI24695J34938_10017537 3300002450 Bacteria 3603
81 JGI24695J34938_10028704 3300002450 Bacteria 2611
82 Ga0264413_140669 3300024493 Bacteria 1213
83 Ga0466712_227559 3300042614 Bacteria 24106
84 Ga0466702_382887 3300042635 Archaea 1555
85 Ga0123356_10107104 3300010049 Bacteria 2693
86 Ga0123356_10819025 3300010049 Bacteria 1102
87 Ga0466700_302085 3300042600 Bacteria 2124
88 Ga0466720_082087 3300042607 Bacteria 4231
89 JGI24698J34947_10017785 3300002449 Bacteria 3849
90 JGI24698J34947_10069602 3300002449 Bacteria 1697
91 JGI24695J34938_10000032 3300002450 Bacteria 104156
92 JGI24695J34938_10001471 3300002450 Bacteria 19909
93 JGI24695J34938_10001563 3300002450 Bacteria 19296
94 JGI24695J34938_10001685 3300002450 Bacteria 18303
95 JGI24695J34938_10001907 3300002450 Bacteria 16849
96 Ga0072941_1000555 3300005201 Bacteria 1697
97 Ga0466699_184644 3300042597 Bacteria 5443
98 Ga0466712_113361 3300042614 Bacteria 28866
99 Ga0466712_139157 3300042614 Bacteria 70891
100 Ga0466728_206673 3300042620 Bacteria 1530
101 Ga0466735_063415 3300042624 Bacteria 1081
102 Ga0466735_117115 3300042624 Bacteria 2242
103 Ga0123356_10000496 3300010049 Bacteria 43882
104 Ga0123356_10094158 3300010049 Bacteria 2860
105 Ga0123356_10197225 3300010049 Bacteria 2050
106 Ga0466700_042949 3300042600 Unclassified 2903
107 AustNasuHG_c1016656 3300000089 Bacteria 2454
108 JGI24698J34947_10025596 3300002449 Bacteria 3140
109 JGI24698J34947_10026800 3300002449 Bacteria 3060
110 JGI24695J34938_10001535 3300002450 Bacteria 19471
111 JGI24695J34938_10012761 3300002450 Bacteria 4440
112 JGI24695J34938_10193964 3300002450 Bacteria 844
113 JGI24702J35022_10002043 3300002462 Bacteria 12442
114 Ga0072941_1000556 3300005201 Bacteria 5884
115 Ga0072941_1000595 3300005201 Bacteria 6008
116 Ga0072941_1002785 3300005201 Bacteria 6538
117 Ga0415639_057567 3300038395 Bacteria 6897
118 Ga0466695_115832 3300042595 Bacteria 38752
119 Ga0466699_129726 3300042597 Bacteria 22844

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.