Protein Family IF00599

Metagenome Isolate
163 Members
48 Samples
142 Scaffolds
247.14 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10000998|JGI24695J34938_100009985
Length
278 aa
Sequence
VELGVRSEELGMRNEDEEIFYKIHWRFVMDRIVFFIFIILAVVVFPLGVFAQTPGAAELLRRVDNNEIYTTIEYEGEIVIENGGRRFVKTMKAWARGNTHSFIEFTNTEDRGTKYLKRDGRLFVYSPDTEEVILISGHMLKESMMGSDMSYEDTLNNETLASRYDPVIEGSEVISGRDAWVLKLTAKRRTESYPSRKLWIDKENGDLLRYELFALSGVKLKEYNLRRVEVIGGRRFPVEGEMRDLMRRDSRTVFIMRNVVLDRPIADSVFSQRNLER*

📊 Sample Types

Isolate 12.9%
Metagenome 87.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.5%
Termitidae 43.5%
Kalotermitidae 8.7%
Termopsidae 4.3%

🌳 Taxonomy

Archaea 1
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
11 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
14 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
20 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
21 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
22 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
23 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
29 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
30 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
31 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
39 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
40 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
41 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
42 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
43 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
44 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466694_172853 3300042594 Bacteria 3872
2 Ga0123356_10008431 3300010049 Bacteria 10250
3 Ga0123356_11311426 3300010049 Bacteria 887
4 Ga0123353_11399024 3300010167 Bacteria 899
5 AustNasuHG_c1002105 3300000089 Bacteria 7190
6 JGI24698J34947_10017104 3300002449 Bacteria 3934
7 JGI24698J34947_10021289 3300002449 Bacteria 3490
8 JGI24698J34947_10026230 3300002449 Bacteria 3098
9 JGI24698J34947_10063354 3300002449 Unclassified 1812
10 JGI24695J34938_10000998 3300002450 Bacteria 25695
11 JGI24695J34938_10013057 3300002450 Bacteria 4375
12 JGI24695J34938_10097846 3300002450 Bacteria 1200
13 Ga0466712_048188 3300042614 Unclassified 2128
14 Ga0466712_129786 3300042614 Bacteria 6105
15 Ga0466698_416332 3300042610 Bacteria 1764
16 Ga0466703_265347 3300042636 Bacteria 5679
17 Ga0466704_116664 3300042643 Archaea 3313
18 Ga0466699_155429 3300042597 Bacteria 21075
19 Ga0466732_299929 3300042656 Bacteria 7670
20 Ga0466732_346341 3300042656 Bacteria 1872
21 Ga0123356_10000425 3300010049 Bacteria 48140
22 Ga0123356_10000612 3300010049 Bacteria 39404
23 Ga0123356_10006055 3300010049 Bacteria 12271
24 Ga0123356_10013029 3300010049 Bacteria 8044
25 Ga0123353_10609265 3300010167 Unclassified 1558
26 AustNasuHG_c1010345 3300000089 Bacteria 3252
27 JGI24695J34938_10003243 3300002450 Bacteria 11509
28 JGI24695J34938_10003360 3300002450 Bacteria 11256
29 JGI24695J34938_10097831 3300002450 Unclassified 1200
30 Ga0072941_1005723 3300005201 Bacteria 33074
31 Ga0466712_048235 3300042614 Unclassified 1011
32 Ga0466712_264940 3300042614 Bacteria 25363
33 Ga0466731_395461 3300042622 Bacteria 1516
34 Ga0466702_037390 3300042635 Bacteria 11627
35 Ga0264413_113985 3300024493 Bacteria 28252
36 Ga0466693_272869 3300042592 Bacteria 5920
37 Ga0466694_157142 3300042594 Bacteria 6974
38 Ga0466732_148630 3300042656 Bacteria 15820
39 Ga0123356_10000351 3300010049 Bacteria 52507
40 AustNasuHG_c1001497 3300000089 Bacteria 8376
41 JGI24698J34947_10059912 3300002449 Bacteria 1880
42 JGI24698J34947_10132409 3300002449 Unclassified 1063
43 JGI24698J34947_10142034 3300002449 Bacteria 1010
44 JGI24695J34938_10000625 3300002450 Bacteria 33733
45 JGI24695J34938_10000646 3300002450 Bacteria 33261
46 JGI24695J34938_10001679 3300002450 Bacteria 18333
47 JGI24695J34938_10002220 3300002450 Bacteria 15105
48 JGI24695J34938_10006303 3300002450 Bacteria 7174
49 Ga0072941_1005668 3300005201 Bacteria 10675
50 Ga0466712_023839 3300042614 Bacteria 59773
51 Ga0466718_022400 3300042617 Bacteria 2072
52 Ga0466700_099697 3300042600 Bacteria 9868
53 Ga0466720_063730 3300042607 Bacteria 6174
54 Ga0466727_225608 3300042655 Bacteria 1238
55 Ga0415639_068091 3300038395 Bacteria 5994
56 Ga0466699_252951 3300042597 Bacteria 10768
57 Ga0123356_10003335 3300010049 Bacteria 16854
58 Ga0123356_10610235 3300010049 Bacteria 1256
59 AustNasuHG_c1001542 3300000089 Bacteria 8290
60 AustNasuHG_c1027422 3300000089 Unclassified 1739
61 JGI24698J34947_10051108 3300002449 Bacteria 2081
62 JGI24698J34947_10057802 3300002449 Bacteria 1923
63 JGI24698J34947_10064275 3300002449 Bacteria 1794
64 JGI24698J34947_10066617 3300002449 Unclassified 1751
65 JGI24698J34947_10108293 3300002449 Bacteria 1232
66 JGI24695J34938_10000189 3300002450 Bacteria 57805
67 JGI24695J34938_10001536 3300002450 Bacteria 19468
68 JGI24695J34938_10001942 3300002450 Bacteria 16615
69 JGI24695J34938_10003316 3300002450 Bacteria 11341
70 JGI24695J34938_10023566 3300002450 Bacteria 2966
71 JGI24695J34938_10123547 3300002450 Bacteria 1054
72 JGI24697J35500_11213188 3300002507 Unclassified 1793
73 Ga0466712_128533 3300042614 Bacteria 1468
74 Ga0466720_023164 3300042607 Bacteria 11554
75 Ga0466720_128196 3300042607 Bacteria 1272
76 Ga0466720_182937 3300042607 Bacteria 5637
77 Ga0466731_058864 3300042622 Bacteria 6526
78 Ga0466694_047338 3300042594 Bacteria 2752
79 Ga0123356_10002382 3300010049 Bacteria 20132
80 Ga0123356_10125359 3300010049 Bacteria 2506
81 JGI24698J34947_10008977 3300002449 Bacteria 5481
82 JGI24698J34947_10068897 3300002449 Bacteria 1709
83 JGI24698J34947_10095423 3300002449 Unclassified 1352
84 JGI24698J34947_10174201 3300002449 Bacteria 867
85 JGI24695J34938_10000036 3300002450 Bacteria 101915
86 JGI24695J34938_10001733 3300002450 Bacteria 18026
87 Ga0072941_1010093 3300005201 Bacteria 4362
88 Ga0466712_067966 3300042614 Bacteria 5600
89 Ga0466712_114377 3300042614 Unclassified 2313
90 Ga0466712_137864 3300042614 Unclassified 1898
91 Ga0466712_165395 3300042614 Bacteria 2707
92 Ga0466703_203927 3300042636 Bacteria 12098
93 Ga0466694_086246 3300042594 Bacteria 1633
94 Ga0123353_10347998 3300010167 Bacteria 2235
95 JGI24698J34947_10014799 3300002449 Bacteria 4248
96 JGI24698J34947_10044463 3300002449 Bacteria 2273
97 JGI24698J34947_10170440 3300002449 Bacteria 881
98 JGI24695J34938_10003205 3300002450 Bacteria 11598
99 JGI24695J34938_10005904 3300002450 Bacteria 7502
100 JGI24695J34938_10016796 3300002450 Bacteria 3711
101 Ga0466712_013430 3300042614 Bacteria 12564
102 Ga0466712_144071 3300042614 Bacteria 18902
103 Ga0466718_086113 3300042617 Bacteria 1731
104 Ga0466718_122818 3300042617 Bacteria 1883
105 Ga0466726_468204 3300042619 Bacteria 2367
106 Ga0466720_057004 3300042607 Bacteria 41550
107 Ga0466702_389981 3300042635 Bacteria 1491
108 Ga0415639_054665 3300038395 Bacteria 3351
109 Ga0466693_432005 3300042592 Unclassified 1257
110 Ga0123356_10204456 3300010049 Bacteria 2017
111 JGI24698J34947_10004656 3300002449 Bacteria 7482
112 JGI24698J34947_10088260 3300002449 Unclassified 1431
113 JGI24698J34947_10153288 3300002449 Bacteria 954
114 JGI24695J34938_10003532 3300002450 Bacteria 10832
115 Ga0072941_1164579 3300005201 Bacteria 3851
116 Ga0466712_091044 3300042614 Unclassified 1292
117 Ga0466711_013664 3300042615 Bacteria 7816
118 Ga0466702_054127 3300042635 Bacteria 9159
119 Ga0466702_093285 3300042635 Bacteria 1337
120 Ga0466690_036208 3300042590 Bacteria 1379
121 Ga0466693_135525 3300042592 Bacteria 26238
122 Ga0466694_050440 3300042594 Bacteria 148325
123 Ga0466694_067051 3300042594 Bacteria 3302
124 Ga0466694_149803 3300042594 Bacteria 4619
125 Ga0123356_10033179 3300010049 Bacteria 4827
126 Ga0123356_10238408 3300010049 Unclassified 1888
127 Ga0123356_10512563 3300010049 Bacteria 1357
128 JGI24698J34947_10009177 3300002449 Bacteria 5426
129 JGI24698J34947_10108823 3300002449 Unclassified 1228
130 JGI24698J34947_10132658 3300002449 Bacteria 1062
131 JGI24695J34938_10001031 3300002450 Bacteria 25228
132 JGI24695J34938_10001253 3300002450 Bacteria 22314
133 JGI24699J35502_11123505 3300002509 Bacteria 3556
134 Ga0466712_017964 3300042614 Bacteria 12881
135 Ga0466712_112876 3300042614 Bacteria 6961
136 Ga0466712_162181 3300042614 Bacteria 1379
137 Ga0466712_166536 3300042614 Bacteria 7397
138 Ga0466718_002144 3300042617 Bacteria 2307
139 Ga0466718_039490 3300042617 Bacteria 2296
140 Ga0466718_065080 3300042617 Unclassified 2565
141 Ga0466721_077124 3300042608 Bacteria 1630
142 Ga0466702_149333 3300042635 Bacteria 8423

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17131 LolA_like Outer membrane lipoprotein-sorting protein 97 277 0.98
PF03888 MucB_RseB MucB/RseB N-terminal domain 68 223 0.73

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.