Protein Family IF00531
Metagenome
Isolate
111
Members
19
Samples
110
Scaffolds
162.5
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10038421|JGI24698J34947_100384212
- Length
- 189 aa
- Sequence
- MSKSLVTESPDMLCNKAEKDILAVKVLAGKKFFPEDRMYDIICFHATQAVEKLLKSYIISNGKTIEKIHNLDILQKASMEIDDSFFKIMDNCLLLNEFIPNIRYDNENPVTKQHMRDILKSLDIICNFSPIKTMRDSFSKKHKYEIVVEVTARPAKPAAKNGKKTSGKGTGEEESHTEVRRHGGHKDR*
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Termitidae
38.9%
Rhinotermitidae
5.6%
Unclassified
5.6%
Taxonomy
Archaea
0
Bacteria
91
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 3 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_150659 | 3300042614 | Bacteria | 9540 |
| 2 | Ga0123356_10000186 | 3300010049 | Bacteria | 71358 |
| 3 | Ga0466704_096056 | 3300042643 | Bacteria | 1295 |
| 4 | JGI24698J34947_10001366 | 3300002449 | Bacteria | 12833 |
| 5 | JGI24698J34947_10001392 | 3300002449 | Bacteria | 12718 |
| 6 | JGI24698J34947_10001881 | 3300002449 | Bacteria | 11192 |
| 7 | JGI24698J34947_10034644 | 3300002449 | Unclassified | 2640 |
| 8 | JGI24698J34947_10106561 | 3300002449 | Bacteria | 1247 |
| 9 | JGI24698J34947_10148002 | 3300002449 | Bacteria | 979 |
| 10 | JGI24698J34947_10213615 | 3300002449 | Unclassified | 745 |
| 11 | Ga0072941_1042129 | 3300005201 | Unclassified | 1685 |
| 12 | Ga0072941_1231584 | 3300005201 | Bacteria | 1074 |
| 13 | Ga0466712_049770 | 3300042614 | Bacteria | 2268 |
| 14 | Ga0466712_063680 | 3300042614 | Bacteria | 1081 |
| 15 | Ga0466712_169223 | 3300042614 | Bacteria | 14839 |
| 16 | Ga0466712_294891 | 3300042614 | Bacteria | 1987 |
| 17 | Ga0466712_311548 | 3300042614 | Bacteria | 10714 |
| 18 | Ga0466691_017788 | 3300042593 | Bacteria | 1621 |
| 19 | JGI24698J34947_10016342 | 3300002449 | Bacteria | 4028 |
| 20 | JGI24698J34947_10024999 | 3300002449 | Bacteria | 3182 |
| 21 | JGI24698J34947_10041078 | 3300002449 | Bacteria | 2384 |
| 22 | JGI24698J34947_10068780 | 3300002449 | Bacteria | 1711 |
| 23 | JGI24698J34947_10085579 | 3300002449 | Bacteria | 1464 |
| 24 | JGI24698J34947_10134629 | 3300002449 | Bacteria | 1051 |
| 25 | JGI24699J35502_11127186 | 3300002509 | Bacteria | 4103 |
| 26 | Ga0072941_1005975 | 3300005201 | Bacteria | 27344 |
| 27 | Ga0466712_029234 | 3300042614 | Bacteria | 4634 |
| 28 | Ga0466712_051308 | 3300042614 | Unclassified | 2671 |
| 29 | Ga0466712_059905 | 3300042614 | Unclassified | 4084 |
| 30 | Ga0466692_113055 | 3300042591 | Unclassified | 1381 |
| 31 | JGI24698J34947_10003324 | 3300002449 | Bacteria | 8725 |
| 32 | JGI24698J34947_10051139 | 3300002449 | Unclassified | 2080 |
| 33 | JGI24698J34947_10058955 | 3300002449 | Bacteria | 1899 |
| 34 | JGI24698J34947_10085401 | 3300002449 | Bacteria | 1466 |
| 35 | JGI24698J34947_10132286 | 3300002449 | Bacteria | 1064 |
| 36 | JGI24698J34947_10168391 | 3300002449 | Bacteria | 890 |
| 37 | JGI24699J35502_11124945 | 3300002509 | Bacteria | 3726 |
| 38 | Ga0072941_1011778 | 3300005201 | Bacteria | 17019 |
| 39 | Ga0072941_1022163 | 3300005201 | Bacteria | 4402 |
| 40 | Ga0072941_1078293 | 3300005201 | Bacteria | 4056 |
| 41 | Ga0466712_015419 | 3300042614 | Bacteria | 11672 |
| 42 | Ga0466712_288021 | 3300042614 | Unclassified | 1068 |
| 43 | Ga0466719_064630 | 3300042606 | Bacteria | 2468 |
| 44 | Ga0466703_270377 | 3300042636 | Bacteria | 2887 |
| 45 | Ga0466691_189985 | 3300042593 | Bacteria | 1676 |
| 46 | JGI24698J34947_10019438 | 3300002449 | Bacteria | 3663 |
| 47 | JGI24698J34947_10036131 | 3300002449 | Bacteria | 2574 |
| 48 | JGI24698J34947_10075589 | 3300002449 | Unclassified | 1601 |
| 49 | Ga0072941_1022719 | 3300005201 | Bacteria | 3601 |
| 50 | Ga0466705_168372 | 3300042612 | Bacteria | 1589 |
| 51 | Ga0466712_041022 | 3300042614 | Bacteria | 3937 |
| 52 | Ga0466712_058780 | 3300042614 | Bacteria | 7747 |
| 53 | Ga0466712_175862 | 3300042614 | Bacteria | 3891 |
| 54 | Ga0466712_190353 | 3300042614 | Bacteria | 10750 |
| 55 | Ga0466712_219615 | 3300042614 | Bacteria | 2923 |
| 56 | Ga0466712_307183 | 3300042614 | Bacteria | 9122 |
| 57 | Ga0466703_228798 | 3300042636 | Bacteria | 1819 |
| 58 | Ga0466708_316619 | 3300042652 | Bacteria | 1439 |
| 59 | JGI24698J34947_10126445 | 3300002449 | Bacteria | 1100 |
| 60 | JGI24698J34947_10140007 | 3300002449 | Bacteria | 1021 |
| 61 | JGI24698J34947_10195940 | 3300002449 | Unclassified | 795 |
| 62 | Ga0072941_1000711 | 3300005201 | Bacteria | 18229 |
| 63 | Ga0072941_1001764 | 3300005201 | Bacteria | 16180 |
| 64 | Ga0072941_1059324 | 3300005201 | Bacteria | 2328 |
| 65 | Ga0466712_005661 | 3300042614 | Bacteria | 10779 |
| 66 | Ga0466712_094709 | 3300042614 | Bacteria | 4615 |
| 67 | Ga0466712_108346 | 3300042614 | Bacteria | 1057 |
| 68 | Ga0466712_263028 | 3300042614 | Bacteria | 1609 |
| 69 | Ga0466712_317566 | 3300042614 | Unclassified | 1852 |
| 70 | Ga0466718_133191 | 3300042617 | Bacteria | 1883 |
| 71 | Ga0466728_117927 | 3300042620 | Bacteria | 2128 |
| 72 | Ga0466690_140116 | 3300042590 | Bacteria | 1714 |
| 73 | Ga0466690_418715 | 3300042590 | Bacteria | 1778 |
| 74 | Ga0466694_390381 | 3300042594 | Unclassified | 1168 |
| 75 | JGI24698J34947_10015690 | 3300002449 | Unclassified | 4120 |
| 76 | JGI24698J34947_10020189 | 3300002449 | Bacteria | 3591 |
| 77 | JGI24698J34947_10106010 | 3300002449 | Bacteria | 1251 |
| 78 | JGI24698J34947_10200615 | 3300002449 | Bacteria | 781 |
| 79 | JGI24698J34947_10214383 | 3300002449 | Bacteria | 743 |
| 80 | JGI24699J35502_11065720 | 3300002509 | Unclassified | 1787 |
| 81 | Ga0072941_1072723 | 3300005201 | Unclassified | 9254 |
| 82 | Ga0072941_1107939 | 3300005201 | Bacteria | 3824 |
| 83 | Ga0466712_171101 | 3300042614 | Bacteria | 3376 |
| 84 | Ga0466712_178957 | 3300042614 | Bacteria | 10647 |
| 85 | Ga0466712_205490 | 3300042614 | Bacteria | 2166 |
| 86 | Ga0466728_099371 | 3300042620 | Bacteria | 1837 |
| 87 | Ga0123356_12310125 | 3300010049 | Unclassified | 673 |
| 88 | Ga0466708_125382 | 3300042652 | Bacteria | 3448 |
| 89 | JGI24698J34947_10004378 | 3300002449 | Bacteria | 7684 |
| 90 | JGI24698J34947_10038421 | 3300002449 | Bacteria | 2483 |
| 91 | JGI24698J34947_10052580 | 3300002449 | Unclassified | 2043 |
| 92 | JGI24698J34947_10101365 | 3300002449 | Unclassified | 1294 |
| 93 | JGI24698J34947_10119785 | 3300002449 | Bacteria | 1145 |
| 94 | Ga0466712_067659 | 3300042614 | Bacteria | 3986 |
| 95 | Ga0466712_093792 | 3300042614 | Bacteria | 3691 |
| 96 | Ga0466712_145407 | 3300042614 | Bacteria | 3858 |
| 97 | Ga0466712_269782 | 3300042614 | Bacteria | 2763 |
| 98 | Ga0466728_405340 | 3300042620 | Bacteria | 2793 |
| 99 | Ga0466716_248905 | 3300042605 | Bacteria | 1266 |
| 100 | Ga0466691_134504 | 3300042593 | Bacteria | 11171 |
| 101 | JGI24698J34947_10001489 | 3300002449 | Bacteria | 12376 |
| 102 | JGI24698J34947_10014550 | 3300002449 | Bacteria | 4285 |
| 103 | JGI24698J34947_10020138 | 3300002449 | Bacteria | 3596 |
| 104 | JGI24698J34947_10025808 | 3300002449 | Bacteria | 3125 |
| 105 | JGI24698J34947_10041239 | 3300002449 | Bacteria | 2378 |
| 106 | JGI24698J34947_10052301 | 3300002449 | Bacteria | 2050 |
| 107 | JGI24698J34947_10066869 | 3300002449 | Bacteria | 1747 |
| 108 | JGI24698J34947_10091242 | 3300002449 | Unclassified | 1397 |
| 109 | JGI24698J34947_10101706 | 3300002449 | Bacteria | 1290 |
| 110 | JGI24697J35500_10988093 | 3300002507 | Unclassified | 924 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05168 | HEPN | HEPN domain | 14 | 128 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.