Protein Family IF00491
Metagenome
Isolate
130
Members
46
Samples
122
Scaffolds
693.05
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10005628|JGI24698J34947_100056282
- Length
- 728 aa
- Sequence
- MSKWGRKLLLMHTLIPYNAVMNRETKISELISKMTLEEKVSQLTHASPAIPRLGIPEYNWWNECLHGVARAGVATVFPQAIALAATFDETLVHEVAGAISDEARAKYNEAVKQGNRGQYWGLTFWTPNINIFRDPRWGRGQETYGEDPYLTGRIGLAFVRGLQGDDPENLKLAAXAKHYAVHSGPEKFRHTFNAVVSQKDLFETYLPAFRALVEAGVESVMGAYNRTLGEVCCASDYLIKDILRGRWAFKGHFVSDCWAIRDFHEHHKITKTPEESAALALNAGCDLNCGCTYPYLTASLKKGLVTEEAINTALERLLRTRFKLGMFDPPEHGRWGKLGRDVINCERHQKLALKAAEKSIVLLKNDKGLLPLDSSAKKLVVVGPAAANAHALFGNYYGVSSRFVTILEGLAEKVRDIYGINLEYRQGCLMYGYNNTSNPEFGQVEAAGMAMTFGQANPADIIIAVMGLDGAIEGEEGDAIASDSNGDRASIELPPWQLQFLQAIRAAGKSVILILTGGSPIAIPEDIADAIIFAWYPGELGGRAVADIIFGDVVPSGKLPITFPASTVQLPPYEDYSMKGRTYRYMTEKPLYPFGFGLSYTSFRFDSISLSAQSMSPNDTVTAAVTVSNTGKRDADEVVQIYIVKDDRGADDPLSSLKAFRRVSVPSGKSVTVEFELPAAAFETITAAGEPALIPGSYTVIAADSSPVSASTEKGAPAPVSAKVRVH*
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
31.1%
Unclassified
17.8%
Rhinotermitidae
4.4%
Termopsidae
2.2%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 7 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 41 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466699_010155 | 3300042597 | Bacteria | 15771 |
| 2 | Ga0466699_116566 | 3300042597 | Bacteria | 14666 |
| 3 | Ga0466699_328840 | 3300042597 | Bacteria | 14017 |
| 4 | Ga0466720_014684 | 3300042607 | Bacteria | 5900 |
| 5 | Ga0466720_036422 | 3300042607 | Bacteria | 3534 |
| 6 | Ga0466720_038694 | 3300042607 | Bacteria | 8475 |
| 7 | Ga0466720_039745 | 3300042607 | Bacteria | 2907 |
| 8 | JGI24698J34947_10000646 | 3300002449 | Bacteria | 16856 |
| 9 | JGI24698J34947_10001069 | 3300002449 | Bacteria | 14094 |
| 10 | JGI24698J34947_10014499 | 3300002449 | Bacteria | 4291 |
| 11 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 12 | JGI24695J34938_10000234 | 3300002450 | Bacteria | 52922 |
| 13 | JGI24695J34938_10003443 | 3300002450 | Bacteria | 11051 |
| 14 | JGI24695J34938_10007033 | 3300002450 | Bacteria | 6663 |
| 15 | JGI24695J34938_10007827 | 3300002450 | Bacteria | 6187 |
| 16 | Ga0072941_1006486 | 3300005201 | Bacteria | 33115 |
| 17 | Ga0123353_10040123 | 3300010167 | Bacteria | 7382 |
| 18 | Ga0466732_287796 | 3300042656 | Bacteria | 3037 |
| 19 | Ga0466712_126441 | 3300042614 | Bacteria | 83990 |
| 20 | Ga0466711_367581 | 3300042615 | Bacteria | 22515 |
| 21 | Ga0466718_013140 | 3300042617 | Bacteria | 10114 |
| 22 | Ga0466723_135272 | 3300042618 | Bacteria | 14640 |
| 23 | Ga0466692_202348 | 3300042591 | Bacteria | 11392 |
| 24 | Ga0466694_250118 | 3300042594 | Bacteria | 44488 |
| 25 | Ga0466720_001847 | 3300042607 | Bacteria | 14739 |
| 26 | AustNasuHG_c1011247 | 3300000089 | Bacteria | 3103 |
| 27 | JGI24698J34947_10005743 | 3300002449 | Bacteria | 6803 |
| 28 | JGI24702J35022_10000482 | 3300002462 | Bacteria | 24054 |
| 29 | Ga0072941_1004616 | 3300005201 | Bacteria | 18977 |
| 30 | Ga0123356_10000186 | 3300010049 | Bacteria | 71358 |
| 31 | Ga0466712_142190 | 3300042614 | Bacteria | 5751 |
| 32 | Ga0466718_058823 | 3300042617 | Bacteria | 5358 |
| 33 | Ga0466718_060846 | 3300042617 | Unclassified | 5284 |
| 34 | Ga0466699_079870 | 3300042597 | Bacteria | 2902 |
| 35 | Ga0466721_252112 | 3300042608 | Bacteria | 2172 |
| 36 | Ga0466722_006875 | 3300042609 | Bacteria | 5077 |
| 37 | JGI24702J35022_10011192 | 3300002462 | Bacteria | 4998 |
| 38 | Ga0072941_1006799 | 3300005201 | Bacteria | 21372 |
| 39 | Ga0466705_006114 | 3300042612 | Bacteria | 10361 |
| 40 | Ga0466705_248911 | 3300042612 | Bacteria | 6313 |
| 41 | Ga0466712_229358 | 3300042614 | Bacteria | 24428 |
| 42 | Ga0466711_162655 | 3300042615 | Bacteria | 9232 |
| 43 | Ga0466718_045569 | 3300042617 | Bacteria | 37794 |
| 44 | Ga0415639_019797 | 3300038395 | Bacteria | 5193 |
| 45 | Ga0415639_031726 | 3300038395 | Bacteria | 24566 |
| 46 | Ga0466720_126036 | 3300042607 | Bacteria | 7907 |
| 47 | Ga0466722_210060 | 3300042609 | Bacteria | 7982 |
| 48 | Ga0466704_233633 | 3300042643 | Bacteria | 14067 |
| 49 | Ga0466708_055288 | 3300042652 | Bacteria | 15683 |
| 50 | AustNasuHG_c1015691 | 3300000089 | Bacteria | 2551 |
| 51 | JGI24698J34947_10000971 | 3300002449 | Bacteria | 14665 |
| 52 | Ga0072941_1003323 | 3300005201 | Bacteria | 61307 |
| 53 | Ga0072941_1004158 | 3300005201 | Bacteria | 12275 |
| 54 | Ga0466712_016804 | 3300042614 | Bacteria | 11341 |
| 55 | Ga0466712_190364 | 3300042614 | Bacteria | 6472 |
| 56 | Ga0466718_011480 | 3300042617 | Bacteria | 8518 |
| 57 | Ga0466718_022824 | 3300042617 | Bacteria | 6783 |
| 58 | Ga0466723_305983 | 3300042618 | Bacteria | 3988 |
| 59 | Ga0466694_300225 | 3300042594 | Bacteria | 7630 |
| 60 | Ga0466696_298956 | 3300042596 | Bacteria | 3765 |
| 61 | Ga0466696_418989 | 3300042596 | Bacteria | 5568 |
| 62 | Ga0466699_006203 | 3300042597 | Bacteria | 4558 |
| 63 | Ga0466699_281422 | 3300042597 | Bacteria | 13155 |
| 64 | Ga0466716_091245 | 3300042605 | Bacteria | 7246 |
| 65 | Ga0466720_011344 | 3300042607 | Bacteria | 20957 |
| 66 | Ga0072940_1057666 | 3300005200 | Bacteria | 7262 |
| 67 | Ga0123357_10000140 | 3300009784 | Bacteria | 63300 |
| 68 | Ga0466732_297993 | 3300042656 | Bacteria | 7106 |
| 69 | Ga0466712_009402 | 3300042614 | Bacteria | 14469 |
| 70 | Ga0466715_216961 | 3300042616 | Bacteria | 4695 |
| 71 | Ga0466718_053153 | 3300042617 | Bacteria | 9206 |
| 72 | Ga0466690_299107 | 3300042590 | Bacteria | 3710 |
| 73 | Ga0466692_113399 | 3300042591 | Bacteria | 14052 |
| 74 | Ga0466695_218867 | 3300042595 | Bacteria | 114312 |
| 75 | Ga0466716_035235 | 3300042605 | Bacteria | 2540 |
| 76 | Ga0466719_118797 | 3300042606 | Bacteria | 11038 |
| 77 | Ga0466720_055547 | 3300042607 | Bacteria | 8449 |
| 78 | Ga0466720_163947 | 3300042607 | Bacteria | 6855 |
| 79 | Ga0466722_105684 | 3300042609 | Bacteria | 11256 |
| 80 | Ga0466709_155933 | 3300042648 | Bacteria | 22062 |
| 81 | AustNasuHG_c1014765 | 3300000089 | Unclassified | 2646 |
| 82 | JGI24698J34947_10001143 | 3300002449 | Bacteria | 13784 |
| 83 | JGI24698J34947_10005628 | 3300002449 | Bacteria | 6871 |
| 84 | JGI24695J34938_10000316 | 3300002450 | Bacteria | 47576 |
| 85 | JGI24695J34938_10000906 | 3300002450 | Bacteria | 27340 |
| 86 | JGI24695J34938_10008031 | 3300002450 | Bacteria | 6084 |
| 87 | JGI24695J34938_10009420 | 3300002450 | Bacteria | 5430 |
| 88 | JGI24695J34938_10015624 | 3300002450 | Bacteria | 3890 |
| 89 | JGI24702J35022_10006867 | 3300002462 | Bacteria | 6553 |
| 90 | Ga0072941_1002032 | 3300005201 | Bacteria | 29987 |
| 91 | Ga0072941_1007693 | 3300005201 | Bacteria | 51270 |
| 92 | Ga0072941_1012361 | 3300005201 | Unclassified | 5496 |
| 93 | Ga0123357_10000154 | 3300009784 | Bacteria | 61166 |
| 94 | Ga0466712_033719 | 3300042614 | Bacteria | 14827 |
| 95 | Ga0466712_040163 | 3300042614 | Bacteria | 22289 |
| 96 | Ga0466712_054826 | 3300042614 | Bacteria | 21309 |
| 97 | Ga0466712_311510 | 3300042614 | Bacteria | 26569 |
| 98 | Ga0466723_161578 | 3300042618 | Bacteria | 33286 |
| 99 | Ga0466726_003829 | 3300042619 | Bacteria | 4136 |
| 100 | Ga0466728_116288 | 3300042620 | Bacteria | 6077 |
| 101 | Ga0466694_314535 | 3300042594 | Bacteria | 20936 |
| 102 | Ga0466716_098896 | 3300042605 | Bacteria | 6112 |
| 103 | Ga0466720_086055 | 3300042607 | Bacteria | 13531 |
| 104 | Ga0466698_079295 | 3300042610 | Bacteria | 4853 |
| 105 | Ga0466702_279673 | 3300042635 | Bacteria | 21112 |
| 106 | Ga0466708_085239 | 3300042652 | Bacteria | 30570 |
| 107 | JGI24695J34938_10013401 | 3300002450 | Bacteria | 4308 |
| 108 | Ga0466712_196064 | 3300042614 | Bacteria | 8133 |
| 109 | Ga0466712_318831 | 3300042614 | Bacteria | 13299 |
| 110 | Ga0466728_143358 | 3300042620 | Bacteria | 14463 |
| 111 | Ga0466691_050768 | 3300042593 | Bacteria | 73218 |
| 112 | Ga0466720_009690 | 3300042607 | Bacteria | 7803 |
| 113 | Ga0466720_012731 | 3300042607 | Bacteria | 38091 |
| 114 | Ga0466720_020503 | 3300042607 | Bacteria | 7200 |
| 115 | Ga0466703_005378 | 3300042636 | Bacteria | 21587 |
| 116 | Ga0466704_475978 | 3300042643 | Bacteria | 49461 |
| 117 | Ga0466709_050184 | 3300042648 | Bacteria | 11660 |
| 118 | AustNasuHG_c1017438 | 3300000089 | Unclassified | 2388 |
| 119 | JGI24695J34938_10012868 | 3300002450 | Bacteria | 4417 |
| 120 | Ga0123356_10000292 | 3300010049 | Bacteria | 57576 |
| 121 | Ga0123356_10043022 | 3300010049 | Bacteria | 4205 |
| 122 | Ga0123354_10199183 | 3300010882 | Bacteria | 2209 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.