Protein Family IF00488
Metagenome
Isolate
116
Members
36
Samples
104
Scaffolds
231.92
Avg Length
Representative Sequence
- ID
- 3300002449|JGI24698J34947_10005333|JGI24698J34947_100053331
- Length
- 258 aa
- Sequence
- LNDEGGGIGRACLLNAVNLRYRNMIRRGFFSLFFIFLAFPLFAQEHDAGQHQYVIRGEVFVDFEPIYAGHIDSEYPLDITAAGQRALEEAALFFSAMIYGWSFDYEIGEMARQIAENLELTPAALIQPGDPALTVTDTEIRDMRFRIWTDYHLSDAQQRRMQVWRGGTVRNAQAVGYGPSFIEEYPGWLELKKTALEDAARAAIRAMLRGSERNRPKEARGFISLAAFPRYFIDSGRWAVSARFRVQITEIIPFSVY*
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Unclassified
37.1%
Kalotermitidae
14.3%
Rhinotermitidae
2.9%
Termopsidae
2.9%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 2 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 7 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 13 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 14 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 23 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 33 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 34 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 35 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10022277 | 3300002449 | Bacteria | 3400 |
| 2 | JGI24698J34947_10111937 | 3300002449 | Bacteria | 1203 |
| 3 | JGI24695J34938_10001560 | 3300002450 | Bacteria | 19317 |
| 4 | Ga0072941_1040920 | 3300005201 | Bacteria | 2921 |
| 5 | Ga0466712_050586 | 3300042614 | Bacteria | 5978 |
| 6 | Ga0466712_064568 | 3300042614 | Bacteria | 2935 |
| 7 | Ga0466712_198881 | 3300042614 | Bacteria | 7679 |
| 8 | Ga0466694_052647 | 3300042594 | Bacteria | 10895 |
| 9 | Ga0123356_10459045 | 3300010049 | Bacteria | 1423 |
| 10 | Ga0123356_11118452 | 3300010049 | Bacteria | 956 |
| 11 | Ga0466731_194103 | 3300042622 | Bacteria | 8068 |
| 12 | Ga0466703_124592 | 3300042636 | Bacteria | 15584 |
| 13 | Ga0466733_158735 | 3300042659 | Bacteria | 50854 |
| 14 | JGI24698J34947_10010172 | 3300002449 | Bacteria | 5158 |
| 15 | JGI24698J34947_10036229 | 3300002449 | Bacteria | 2570 |
| 16 | JGI24698J34947_10042294 | 3300002449 | Unclassified | 2342 |
| 17 | JGI24698J34947_10175897 | 3300002449 | Bacteria | 861 |
| 18 | JGI24695J34938_10003904 | 3300002450 | Bacteria | 10083 |
| 19 | JGI24695J34938_10020115 | 3300002450 | Bacteria | 3291 |
| 20 | Ga0072941_1040190 | 3300005201 | Bacteria | 9082 |
| 21 | Ga0466712_100050 | 3300042614 | Bacteria | 5780 |
| 22 | Ga0466726_114588 | 3300042619 | Bacteria | 3616 |
| 23 | Ga0123356_10269319 | 3300010049 | Bacteria | 1792 |
| 24 | Ga0466704_333058 | 3300042643 | Bacteria | 1150 |
| 25 | Ga0466733_049236 | 3300042659 | Bacteria | 1140 |
| 26 | JGI24698J34947_10108182 | 3300002449 | Bacteria | 1233 |
| 27 | JGI24695J34938_10059969 | 3300002450 | Unclassified | 1625 |
| 28 | Ga0466718_060939 | 3300042617 | Bacteria | 1466 |
| 29 | Ga0415639_047508 | 3300038395 | Bacteria | 4544 |
| 30 | Ga0415639_093369 | 3300038395 | Bacteria | 1251 |
| 31 | Ga0466693_091694 | 3300042592 | Bacteria | 3939 |
| 32 | Ga0466694_038969 | 3300042594 | Bacteria | 2279 |
| 33 | Ga0123356_10001913 | 3300010049 | Bacteria | 22561 |
| 34 | Ga0123356_10015697 | 3300010049 | Bacteria | 7251 |
| 35 | Ga0123356_10186641 | 3300010049 | Bacteria | 2100 |
| 36 | Ga0123356_11549675 | 3300010049 | Bacteria | 819 |
| 37 | Ga0466716_198027 | 3300042605 | Unclassified | 2103 |
| 38 | Ga0466731_240367 | 3300042622 | Bacteria | 2533 |
| 39 | Ga0466702_119792 | 3300042635 | Bacteria | 2916 |
| 40 | Ga0466733_082783 | 3300042659 | Bacteria | 1536 |
| 41 | Ga0466733_218886 | 3300042659 | Bacteria | 90684 |
| 42 | JGI24695J34938_10000521 | 3300002450 | Bacteria | 37428 |
| 43 | JGI24695J34938_10000572 | 3300002450 | Bacteria | 35404 |
| 44 | JGI24695J34938_10002765 | 3300002450 | Bacteria | 12886 |
| 45 | JGI24695J34938_10054578 | 3300002450 | Bacteria | 1731 |
| 46 | Ga0466694_124269 | 3300042594 | Bacteria | 3761 |
| 47 | Ga0466702_073469 | 3300042635 | Bacteria | 14454 |
| 48 | Ga0466702_324891 | 3300042635 | Bacteria | 1060 |
| 49 | Ga0466733_072555 | 3300042659 | Bacteria | 26214 |
| 50 | JGI24698J34947_10033096 | 3300002449 | Bacteria | 2712 |
| 51 | JGI24698J34947_10085933 | 3300002449 | Bacteria | 1460 |
| 52 | JGI24698J34947_10101289 | 3300002449 | Unclassified | 1294 |
| 53 | JGI24695J34938_10012165 | 3300002450 | Bacteria | 4582 |
| 54 | JGI24695J34938_10016137 | 3300002450 | Bacteria | 3812 |
| 55 | JGI24695J34938_10018986 | 3300002450 | Bacteria | 3419 |
| 56 | JGI24695J34938_10042832 | 3300002450 | Bacteria | 2023 |
| 57 | JGI24695J34938_10059703 | 3300002450 | Bacteria | 1630 |
| 58 | Ga0072941_1008808 | 3300005201 | Bacteria | 16447 |
| 59 | Ga0415639_170977 | 3300038395 | Unclassified | 1437 |
| 60 | Ga0123356_10025400 | 3300010049 | Bacteria | 5569 |
| 61 | Ga0466731_021153 | 3300042622 | Bacteria | 18900 |
| 62 | Ga0466731_084890 | 3300042622 | Bacteria | 1288 |
| 63 | Ga0466704_064610 | 3300042643 | Bacteria | 4131 |
| 64 | Ga0466733_123281 | 3300042659 | Bacteria | 2544 |
| 65 | JGI24698J34947_10005333 | 3300002449 | Bacteria | 7055 |
| 66 | JGI24698J34947_10008217 | 3300002449 | Bacteria | 5726 |
| 67 | JGI24695J34938_10010406 | 3300002450 | Bacteria | 5092 |
| 68 | JGI24695J34938_10108257 | 3300002450 | Bacteria | 1133 |
| 69 | Ga0123356_10000810 | 3300010049 | Bacteria | 34730 |
| 70 | Ga0123356_10054436 | 3300010049 | Bacteria | 3726 |
| 71 | Ga0123356_10349723 | 3300010049 | Bacteria | 1601 |
| 72 | Ga0123356_11239563 | 3300010049 | Bacteria | 911 |
| 73 | Ga0466707_268036 | 3300042601 | Unclassified | 1380 |
| 74 | Ga0466722_152238 | 3300042609 | Bacteria | 2337 |
| 75 | Ga0466702_160223 | 3300042635 | Bacteria | 16616 |
| 76 | Ga0466732_270234 | 3300042656 | Bacteria | 1588 |
| 77 | Ga0466733_177712 | 3300042659 | Bacteria | 1496 |
| 78 | JGI24698J34947_10002492 | 3300002449 | Bacteria | 9942 |
| 79 | JGI24698J34947_10102229 | 3300002449 | Bacteria | 1285 |
| 80 | JGI24695J34938_10030458 | 3300002450 | Bacteria | 2512 |
| 81 | Ga0072941_1050874 | 3300005201 | Bacteria | 3949 |
| 82 | Ga0466712_192425 | 3300042614 | Bacteria | 1050 |
| 83 | Ga0415639_047018 | 3300038395 | Bacteria | 2790 |
| 84 | Ga0466694_039210 | 3300042594 | Bacteria | 2070 |
| 85 | Ga0466694_167042 | 3300042594 | Bacteria | 5498 |
| 86 | Ga0466699_234238 | 3300042597 | Bacteria | 37498 |
| 87 | Ga0123356_10000688 | 3300010049 | Bacteria | 37446 |
| 88 | Ga0123356_10020691 | 3300010049 | Bacteria | 6222 |
| 89 | Ga0466700_032366 | 3300042600 | Bacteria | 11210 |
| 90 | Ga0466733_102310 | 3300042659 | Bacteria | 1365 |
| 91 | Ga0466733_124656 | 3300042659 | Bacteria | 1508 |
| 92 | JGI24698J34947_10011614 | 3300002449 | Bacteria | 4834 |
| 93 | JGI24698J34947_10034822 | 3300002449 | Bacteria | 2632 |
| 94 | JGI24698J34947_10079213 | 3300002449 | Bacteria | 1547 |
| 95 | JGI24695J34938_10000442 | 3300002450 | Bacteria | 40061 |
| 96 | JGI24695J34938_10001449 | 3300002450 | Bacteria | 20095 |
| 97 | JGI24695J34938_10006102 | 3300002450 | Bacteria | 7336 |
| 98 | Ga0072940_1432778 | 3300005200 | Bacteria | 1369 |
| 99 | Ga0466715_005756 | 3300042616 | Bacteria | 12902 |
| 100 | Ga0466693_376710 | 3300042592 | Bacteria | 20175 |
| 101 | Ga0466694_114262 | 3300042594 | Unclassified | 13753 |
| 102 | Ga0466694_183644 | 3300042594 | Bacteria | 11766 |
| 103 | Ga0466696_140033 | 3300042596 | Bacteria | 18405 |
| 104 | Ga0466722_035967 | 3300042609 | Bacteria | 7689 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.