Protein Family IF00481

Metagenome
108 Members
15 Samples
102 Scaffolds
263.82 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10003509|JGI24698J34947_100035098
Length
286 aa
Sequence
MPLVIFSGGFFLFLKTITITNKNMSILFSGDFHANAVNELDSITKNALLEKYEQEKYSGIKYHVILGDGGFMWQGNHKADLFNYKVLAHRPFPVLCVIGNHEPILGMNDIPETDIGIGETVYQINAEPFVAYLKRGKVYTIEGIKFLVLGGALSVDRAIRRPNKTWWEKEYWTEQEERDVFKLLEIENSFDCVISHTGPHHVNKRLFEYVSLSAEKFFDEVAFLNDEIYNKIKFQEWWCGHWHKNCYYFDKEKKHGYQYLYKTTKILEKTDYGLKVHNEYAEVKR*

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 69.2%
Kalotermitidae 30.8%

🌳 Taxonomy

Archaea 0
Bacteria 96
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466699_238175 3300042597 Bacteria 4825
2 Ga0466699_296824 3300042597 Bacteria 1236
3 Ga0466699_364075 3300042597 Bacteria 1312
4 JGI24698J34947_10003468 3300002449 Bacteria 8556
5 JGI24698J34947_10024813 3300002449 Bacteria 3197
6 JGI24698J34947_10043564 3300002449 Bacteria 2300
7 JGI24698J34947_10074330 3300002449 Bacteria 1619
8 Ga0466720_017369 3300042607 Bacteria 21503
9 Ga0466712_057491 3300042614 Bacteria 3035
10 Ga0466712_162998 3300042614 Bacteria 34799
11 Ga0466712_258242 3300042614 Unclassified 4311
12 JGI24698J34947_10002401 3300002449 Bacteria 10082
13 JGI24698J34947_10009503 3300002449 Bacteria 5336
14 JGI24698J34947_10014562 3300002449 Bacteria 4283
15 JGI24698J34947_10055544 3300002449 Bacteria 1972
16 JGI24698J34947_10129768 3300002449 Bacteria 1079
17 Ga0072941_1032238 3300005201 Bacteria 6016
18 Ga0466720_174033 3300042607 Bacteria 4763
19 Ga0466712_268222 3300042614 Bacteria 12935
20 Ga0264413_112628 3300024493 Bacteria 7929
21 Ga0264413_116839 3300024493 Bacteria 1925
22 Ga0466699_017613 3300042597 Bacteria 1518
23 Ga0466699_217340 3300042597 Bacteria 2734
24 Ga0123356_10196192 3300010049 Bacteria 2054
25 Ga0123353_10200678 3300010167 Bacteria 3138
26 JGI24698J34947_10003509 3300002449 Bacteria 8517
27 JGI24698J34947_10006709 3300002449 Bacteria 6322
28 JGI24698J34947_10011608 3300002449 Bacteria 4837
29 JGI24698J34947_10012785 3300002449 Bacteria 4593
30 JGI24698J34947_10014477 3300002449 Bacteria 4296
31 JGI24698J34947_10037863 3300002449 Unclassified 2504
32 JGI24698J34947_10048106 3300002449 Bacteria 2161
33 JGI24698J34947_10082025 3300002449 Bacteria 1509
34 JGI24698J34947_10103697 3300002449 Bacteria 1272
35 Ga0466720_174795 3300042607 Bacteria 3377
36 Ga0466712_183959 3300042614 Bacteria 1840
37 Ga0466712_264012 3300042614 Bacteria 3197
38 Ga0466712_309967 3300042614 Bacteria 1330
39 Ga0466723_114093 3300042618 Bacteria 3461
40 Ga0466699_260512 3300042597 Bacteria 1789
41 Ga0466699_377273 3300042597 Bacteria 6704
42 JGI24698J34947_10004343 3300002449 Bacteria 7718
43 JGI24698J34947_10025057 3300002449 Unclassified 3178
44 JGI24698J34947_10032576 3300002449 Bacteria 2736
45 JGI24698J34947_10041238 3300002449 Bacteria 2378
46 Ga0466712_091946 3300042614 Bacteria 86490
47 Ga0466712_152847 3300042614 Bacteria 7120
48 Ga0466712_275674 3300042614 Bacteria 23810
49 Ga0466690_325311 3300042590 Bacteria 5052
50 JGI24698J34947_10001659 3300002449 Bacteria 11864
51 JGI24698J34947_10002265 3300002449 Bacteria 10315
52 JGI24698J34947_10012381 3300002449 Bacteria 4675
53 JGI24698J34947_10081398 3300002449 Unclassified 1518
54 JGI24698J34947_10101681 3300002449 Bacteria 1291
55 JGI24695J34938_10062888 3300002450 Bacteria 1575
56 Ga0072941_1000097 3300005201 Bacteria 3461
57 Ga0466712_025945 3300042614 Bacteria 27070
58 Ga0466712_183674 3300042614 Bacteria 10081
59 Ga0466708_112328 3300042652 Bacteria 6497
60 JGI24698J34947_10003935 3300002449 Bacteria 8075
61 JGI24698J34947_10009936 3300002449 Bacteria 5216
62 JGI24698J34947_10022313 3300002449 Bacteria 3397
63 JGI24698J34947_10032290 3300002449 Bacteria 2750
64 JGI24698J34947_10037046 3300002449 Bacteria 2536
65 JGI24698J34947_10078746 3300002449 Bacteria 1554
66 JGI24698J34947_10169700 3300002449 Bacteria 884
67 JGI24695J34938_10115881 3300002450 Unclassified 1091
68 JGI24699J35502_10800630 3300002509 Bacteria 880
69 JGI24699J35502_11132117 3300002509 Unclassified 6404
70 Ga0466712_016274 3300042614 Bacteria 13608
71 Ga0466712_085393 3300042614 Bacteria 10735
72 Ga0264413_119336 3300024493 Unclassified 2259
73 Ga0466699_094575 3300042597 Bacteria 9306
74 Ga0466699_129157 3300042597 Bacteria 3611
75 Ga0466699_432884 3300042597 Bacteria 4865
76 Ga0123353_10858725 3300010167 Bacteria 1243
77 JGI24698J34947_10000011 3300002449 Bacteria 46604
78 JGI24698J34947_10056264 3300002449 Bacteria 1957
79 JGI24698J34947_10065432 3300002449 Bacteria 1772
80 Ga0466720_113143 3300042607 Bacteria 27315
81 Ga0466712_000547 3300042614 Bacteria 9827
82 Ga0466712_074489 3300042614 Bacteria 14619
83 Ga0466712_076472 3300042614 Bacteria 5099
84 Ga0466712_169423 3300042614 Bacteria 10051
85 Ga0466712_239788 3300042614 Unclassified 11414
86 Ga0466723_053322 3300042618 Bacteria 5849
87 Ga0466694_061336 3300042594 Unclassified 3074
88 Ga0466694_116517 3300042594 Bacteria 3442
89 JGI24698J34947_10002709 3300002449 Bacteria 9565
90 JGI24698J34947_10004589 3300002449 Bacteria 7529
91 JGI24698J34947_10009303 3300002449 Bacteria 5394
92 JGI24698J34947_10044953 3300002449 Bacteria 2257
93 JGI24698J34947_10068379 3300002449 Unclassified 1718
94 JGI24698J34947_10087759 3300002449 Bacteria 1437
95 JGI24695J34938_10012525 3300002450 Bacteria 4490
96 JGI24695J34938_10036674 3300002450 Bacteria 2233
97 Ga0072941_1024408 3300005201 Bacteria 5729
98 Ga0466720_012201 3300042607 Bacteria 3925
99 Ga0466720_183941 3300042607 Bacteria 14600
100 Ga0466712_177555 3300042614 Unclassified 6819
101 Ga0466712_297669 3300042614 Unclassified 4781
102 Ga0466711_379936 3300042615 Bacteria 1765

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00149 Metallophos Calcineurin-like phosphoesterase 24 244 0.61

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00149 GO:0016787 hydrolase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.