Protein Family IF00466

Metagenome Isolate
117 Members
37 Samples
108 Scaffolds
627.23 Avg Length

🧬 Representative Sequence

ID
3300002449|JGI24698J34947_10000233|JGI24698J34947_100002333
Length
654 aa
Sequence
MNFALKGRVMRINSNLILDDEGRVLILRGANLGGDSKIPFCPPGGEIDPEFLNTKKEISFIGRPFPLEEAESHFSRLKKAGLSFLRLLVTWEAVEHEGPGIYDEAYLAYLRKILLAAEKMDICVFIDPHQDVWSRWTGGDGAPAWTMEKLGMDLDKLDACGAAITRQRYSIYHKSKKHPDGSPYPKMIWPSNYNRYAAATMLSLFFAGITYAPDLQVDGENVQDWLQNRYIAAFRHVQRRLKNCAAIKGWGAMNEPHWGFVGQRNLKLIEDVMIPIGPRPTPWQSIRAASGYQVEVPVYGASSMGKRISHYETFNPQGISLFREGFSCPWKQAGVWKDEGGAPKLLRADHFSKYQDRSPEFADDFLKPFIVKYINAMKEADERGFFFIEGLPHCTDINSHPSWNSNDPCNVINAFHWYDGLSLFTKSFRSWFNVNIDAEKIIIGKKRVGAYFAKCLQKGIDCTRRKMGDVPCLLGEFGLAFDMNNRRGFTTGDYSQHEQALSMYYDAVDSNLLHSTIWNYSASNTNKYGDGWNDEDLSIFSEGRERAAAGWKRPYPMATAGKPVLFKWNRKRGEFVFRFYADREIVSPSLIYLPPEMAPSLEGTSPKIEVRTGGGENLRWEYRYEEQRLLIYNDDYSGEAELKIRSVLNQTLD*

📊 Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.6%
Unclassified 28.6%
Kalotermitidae 20.0%
Termopsidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
2 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
3 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
4 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
5 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
6 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
7 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
8 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
15 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
19 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_151858 3300038395 Bacteria 2512
2 Ga0466690_221697 3300042590 Bacteria 2821
3 Ga0466693_011338 3300042592 Bacteria 13186
4 Ga0466694_051046 3300042594 Bacteria 57740
5 Ga0466716_260907 3300042605 Bacteria 2510
6 Ga0466712_280501 3300042614 Unclassified 2085
7 Ga0466718_044170 3300042617 Bacteria 4468
8 Ga0466718_129838 3300042617 Bacteria 24094
9 AustNasuHG_c1000051 3300000089 Bacteria 30422
10 JGI24698J34947_10000645 3300002449 Bacteria 16857
11 JGI24698J34947_10010700 3300002449 Bacteria 5035
12 JGI24695J34938_10024237 3300002450 Bacteria 2916
13 JGI24700J35501_10888740 3300002508 Bacteria 2629
14 Ga0072940_1113867 3300005200 Bacteria 8981
15 Ga0072941_1000431 3300005201 Bacteria 4044
16 Ga0072941_1007538 3300005201 Bacteria 5801
17 Ga0072941_1012346 3300005201 Bacteria 7254
18 Ga0264413_123900 3300024493 Bacteria 3613
19 Ga0466691_027957 3300042593 Bacteria 22169
20 Ga0466708_037564 3300042652 Bacteria 5239
21 Ga0466712_066534 3300042614 Bacteria 29891
22 Ga0466712_254864 3300042614 Bacteria 9024
23 Ga0466712_318371 3300042614 Bacteria 8235
24 Ga0466723_050790 3300042618 Bacteria 7951
25 Ga0466723_198332 3300042618 Bacteria 2694
26 JGI24698J34947_10000233 3300002449 Bacteria 23039
27 JGI24698J34947_10009242 3300002449 Bacteria 5407
28 JGI24702J35022_10013898 3300002462 Bacteria 4449
29 Ga0264413_104615 3300024493 Bacteria 27626
30 Ga0264413_107331 3300024493 Bacteria 5846
31 Ga0466699_117245 3300042597 Bacteria 16245
32 Ga0466699_351125 3300042597 Bacteria 16883
33 Ga0466707_038654 3300042601 Bacteria 10703
34 Ga0466712_081917 3300042614 Bacteria 63418
35 JGI24698J34947_10025331 3300002449 Bacteria 3159
36 JGI24695J34938_10011318 3300002450 Bacteria 4813
37 JGI24695J34938_10022998 3300002450 Bacteria 3013
38 Ga0072941_1000430 3300005201 Bacteria 6075
39 Ga0072941_1030846 3300005201 Bacteria 9286
40 Ga0072941_1048034 3300005201 Bacteria 7495
41 Ga0466712_044599 3300042614 Bacteria 16671
42 Ga0466712_054361 3300042614 Bacteria 7582
43 Ga0466712_084865 3300042614 Bacteria 39681
44 Ga0466712_158877 3300042614 Bacteria 28725
45 Ga0466715_070372 3300042616 Bacteria 4576
46 JGI24698J34947_10013479 3300002449 Bacteria 4463
47 JGI24698J34947_10020794 3300002449 Bacteria 3533
48 JGI24698J34947_10047954 3300002449 Bacteria 2165
49 JGI24695J34938_10000181 3300002450 Bacteria 58662
50 JGI24695J34938_10001748 3300002450 Bacteria 17965
51 JGI24695J34938_10020044 3300002450 Bacteria 3299
52 Ga0072941_1011859 3300005201 Bacteria 13484
53 Ga0466694_319436 3300042594 Bacteria 51857
54 Ga0466720_224848 3300042607 Bacteria 5637
55 Ga0466712_012702 3300042614 Bacteria 4877
56 Ga0466712_043487 3300042614 Bacteria 20906
57 Ga0466712_246247 3300042614 Bacteria 21510
58 Ga0466718_044314 3300042617 Bacteria 20111
59 AustNasuHG_c1000547 3300000089 Bacteria 13225
60 JGI24698J34947_10024307 3300002449 Bacteria 3237
61 JGI24695J34938_10000591 3300002450 Bacteria 34913
62 JGI24695J34938_10017470 3300002450 Bacteria 3612
63 Ga0072941_1062744 3300005201 Bacteria 3845
64 Ga0123353_10009629 3300010167 Bacteria 13373
65 Ga0415639_126248 3300038395 Bacteria 3244
66 Ga0466690_200197 3300042590 Bacteria 3234
67 Ga0466695_318085 3300042595 Bacteria 14282
68 Ga0466712_104949 3300042614 Bacteria 16888
69 Ga0466712_159058 3300042614 Bacteria 4193
70 Ga0466718_056259 3300042617 Bacteria 4401
71 Ga0466718_103375 3300042617 Bacteria 9563
72 Ga0466728_246130 3300042620 Bacteria 4038
73 JGI24698J34947_10009454 3300002449 Bacteria 5351
74 Ga0123356_10023620 3300010049 Bacteria 5784
75 Ga0415639_060150 3300038395 Bacteria 4346
76 Ga0466691_085450 3300042593 Bacteria 7150
77 Ga0466699_122680 3300042597 Bacteria 7588
78 Ga0466712_274451 3300042614 Bacteria 11220
79 Ga0466712_303257 3300042614 Unclassified 4461
80 Ga0466718_062648 3300042617 Bacteria 6108
81 Ga0466718_131236 3300042617 Bacteria 16931
82 JGI24698J34947_10000061 3300002449 Bacteria 33883
83 JGI24698J34947_10005027 3300002449 Bacteria 7246
84 JGI24698J34947_10008568 3300002449 Bacteria 5613
85 JGI24698J34947_10021190 3300002449 Bacteria 3498
86 JGI24695J34938_10000190 3300002450 Bacteria 57427
87 JGI24695J34938_10006634 3300002450 Bacteria 6905
88 JGI24695J34938_10009803 3300002450 Bacteria 5299
89 JGI24695J34938_10015233 3300002450 Bacteria 3950
90 Ga0072941_1023968 3300005201 Bacteria 6629
91 Ga0123356_10001757 3300010049 Bacteria 23604
92 Ga0123356_10026734 3300010049 Bacteria 5414
93 Ga0466699_008368 3300042597 Bacteria 35242
94 Ga0466699_169800 3300042597 Bacteria 16672
95 Ga0466735_212933 3300042624 Bacteria 3401
96 Ga0466702_222629 3300042635 Bacteria 24290
97 Ga0466720_073547 3300042607 Bacteria 6563
98 Ga0466720_217858 3300042607 Bacteria 11164
99 Ga0466712_062366 3300042614 Bacteria 14422
100 Ga0466712_127075 3300042614 Bacteria 33532
101 AustNasuHG_c1012826 3300000089 Bacteria 2886
102 JGI24698J34947_10009325 3300002449 Unclassified 5388
103 JGI24698J34947_10010376 3300002449 Bacteria 5108
104 JGI24698J34947_10024948 3300002449 Bacteria 3186
105 JGI24695J34938_10000338 3300002450 Bacteria 46275
106 JGI24695J34938_10000366 3300002450 Bacteria 44825
107 Ga0072940_1010386 3300005200 Bacteria 7240
108 Ga0072941_1012151 3300005201 Bacteria 14863

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1010386 Ga0072940_10103867 515
2 3300005201 Ga0072941_1062744 Ga0072941_10627444 516
3 3300024493 Ga0264413_123900 Ga0264413_1239004 520
4 3300042616 Ga0466715_070372 Ga0466715_070372_2044_3768 574
5 3300042605 Ga0466716_260907 Ga0466716_260907_284_2062 592
6 3300042620 Ga0466728_246130 Ga0466728_246130_142_1920 592
7 3300042590 Ga0466690_221697 Ga0466690_221697_812_2605 597
8 3300002450 JGI24695J34938_10015233 JGI24695J34938_100152332 606
9 3300042618 Ga0466723_050790 Ga0466723_050790_948_2849 606
10 3300002450 JGI24695J34938_10000591 JGI24695J34938_1000059126 615
11 3300042624 Ga0466735_212933 Ga0466735_212933_72_1925 617
12 3300002449 JGI24698J34947_10009325 JGI24698J34947_100093255 619
13 3300002449 JGI24698J34947_10013479 JGI24698J34947_100134792 619
14 3300042607 Ga0466720_073547 Ga0466720_073547_3097_4956 619
15 3300042607 Ga0466720_224848 Ga0466720_224848_2206_4065 619
16 3300042614 Ga0466712_254864 Ga0466712_254864_6782_8644 620
17 3300002450 JGI24695J34938_10000338 JGI24695J34938_1000033816 621
18 3300002450 JGI24695J34938_10011318 JGI24695J34938_100113184 622
19 3300038395 Ga0415639_126248 Ga0415639_126248_800_2671 623
20 3300042617 Ga0466718_044314 Ga0466718_044314_14883_16754 623
21 iso_pr_bacteria 2819992462 2819994008 623
22 iso_pr_bacteria 2820020240 2820021355 623
23 3300000089 AustNasuHG_c1000051 AustNasuHG_100005121 624
24 3300042597 Ga0466699_117245 Ga0466699_117245_12553_14427 624
25 3300010049 Ga0123356_10001757 Ga0123356_1000175712 625
26 3300042597 Ga0466699_122680 Ga0466699_122680_3079_4956 625
27 3300042597 Ga0466699_169800 Ga0466699_169800_958_2838 626
28 3300042597 Ga0466699_351125 Ga0466699_351125_1149_3029 626
29 3300042614 Ga0466712_081917 Ga0466712_081917_31297_33177 626
30 iso_pr_bacteria 2781125644 2781295676 626
31 3300002449 JGI24698J34947_10000061 JGI24698J34947_100000616 627
32 3300002450 JGI24695J34938_10000190 JGI24695J34938_1000019051 627
33 3300042614 Ga0466712_066534 Ga0466712_066534_13064_14947 627
34 3300042635 Ga0466702_222629 Ga0466702_222629_16362_18245 627
35 iso_pr_bacteria 2781125645 2781300034 627
36 3300002450 JGI24695J34938_10000366 JGI24695J34938_1000036623 628
37 3300002450 JGI24695J34938_10006634 JGI24695J34938_100066345 628
38 3300005201 Ga0072941_1000430 Ga0072941_10004306 628
39 3300005201 Ga0072941_1012151 Ga0072941_101215110 628
40 3300010049 Ga0123356_10026734 Ga0123356_100267343 628
41 3300038395 Ga0415639_060150 Ga0415639_060150_1804_3690 628
42 iso_pr_bacteria 2781125634 2781275251 628
43 3300010049 Ga0123356_10023620 Ga0123356_100236202 629
44 3300042592 Ga0466693_011338 Ga0466693_011338_10369_12258 629
45 3300042617 Ga0466718_129838 Ga0466718_129838_13477_15366 629
46 3300042617 Ga0466718_131236 Ga0466718_131236_8357_10246 629
47 3300000089 AustNasuHG_c1000547 AustNasuHG_10005474 630
48 3300002449 JGI24698J34947_10009454 JGI24698J34947_100094543 630
49 3300002450 JGI24695J34938_10001748 JGI24695J34938_100017486 630
50 3300002450 JGI24695J34938_10009803 JGI24695J34938_100098034 631
51 3300002450 JGI24695J34938_10024237 JGI24695J34938_100242372 631
52 3300005200 Ga0072940_1113867 Ga0072940_11138673 631
53 3300005201 Ga0072941_1012346 Ga0072941_10123464 632
54 3300010167 Ga0123353_10009629 Ga0123353_100096295 632
55 3300042594 Ga0466694_051046 Ga0466694_051046_30141_32039 632
56 3300042614 Ga0466712_054361 Ga0466712_054361_3974_5872 632
57 3300042614 Ga0466712_084865 Ga0466712_084865_2426_4324 632
58 iso_pr_bacteria 2781125648 2781306050 632
59 3300002450 JGI24695J34938_10020044 JGI24695J34938_100200442 633
60 3300005201 Ga0072941_1000431 Ga0072941_10004313 633
61 3300024493 Ga0264413_104615 Ga0264413_1046153 633
62 3300024493 Ga0264413_107331 Ga0264413_1073314 633
63 3300042597 Ga0466699_008368 Ga0466699_008368_6084_7985 633
64 3300042614 Ga0466712_303257 Ga0466712_303257_1674_3575 633
65 3300042617 Ga0466718_044170 Ga0466718_044170_1697_3598 633
66 3300042617 Ga0466718_056259 Ga0466718_056259_162_2063 633
67 3300042617 Ga0466718_103375 Ga0466718_103375_6819_8720 633
68 iso_pr_bacteria 2819994798 2819994815 633
69 3300000089 AustNasuHG_c1012826 AustNasuHG_10128262 634
70 3300002449 JGI24698J34947_10025331 JGI24698J34947_100253312 634
71 3300002508 JGI24700J35501_10888740 JGI24700J35501_108887401 634
72 3300005201 Ga0072941_1007538 Ga0072941_10075386 634
73 3300042614 Ga0466712_159058 Ga0466712_159058_386_2290 634
74 3300042614 Ga0466712_246247 Ga0466712_246247_17605_19509 634
75 3300042617 Ga0466718_062648 Ga0466718_062648_2062_3966 634
76 3300042618 Ga0466723_198332 Ga0466723_198332_487_2391 634
77 3300002449 JGI24698J34947_10005027 JGI24698J34947_100050273 635
78 3300002449 JGI24698J34947_10010700 JGI24698J34947_100107004 635
79 3300002449 JGI24698J34947_10021190 JGI24698J34947_100211902 635
80 3300002449 JGI24698J34947_10024307 JGI24698J34947_100243072 635
81 3300002449 JGI24698J34947_10024948 JGI24698J34947_100249482 635
82 3300002449 JGI24698J34947_10047954 JGI24698J34947_100479541 635
83 3300005201 Ga0072941_1023968 Ga0072941_10239684 635
84 3300005201 Ga0072941_1048034 Ga0072941_10480343 635
85 3300042595 Ga0466695_318085 Ga0466695_318085_6432_8339 635
86 3300042607 Ga0466720_217858 Ga0466720_217858_4391_6298 635
87 3300042614 Ga0466712_104949 Ga0466712_104949_6858_8765 635
88 3300042614 Ga0466712_280501 Ga0466712_280501_77_1984 635
89 iso_pr_bacteria 2781125641 2781291467 635
90 iso_pr_bacteria 2781125695 2781439012 635
91 3300002449 JGI24698J34947_10020794 JGI24698J34947_100207942 636
92 3300002450 JGI24695J34938_10000181 JGI24695J34938_1000018122 636
93 3300002450 JGI24695J34938_10017470 JGI24695J34938_100174703 636
94 3300002462 JGI24702J35022_10013898 JGI24702J35022_100138981 636
95 3300038395 Ga0415639_151858 Ga0415639_151858_427_2337 636
96 3300042614 Ga0466712_127075 Ga0466712_127075_18019_19929 636
97 3300042614 Ga0466712_158877 Ga0466712_158877_14594_16504 636
98 3300042614 Ga0466712_043487 Ga0466712_043487_2859_4772 637
99 3300002449 JGI24698J34947_10008568 JGI24698J34947_100085687 638
100 3300042614 Ga0466712_062366 Ga0466712_062366_6330_8246 638
101 3300042652 Ga0466708_037564 Ga0466708_037564_3247_5223 638
102 3300002449 JGI24698J34947_10010376 JGI24698J34947_100103765 639
103 3300005201 Ga0072941_1030846 Ga0072941_10308462 639
104 3300042590 Ga0466690_200197 Ga0466690_200197_1057_2979 640
105 3300042614 Ga0466712_012702 Ga0466712_012702_1409_3331 640
106 3300042614 Ga0466712_274451 Ga0466712_274451_6401_8323 640
107 3300042614 Ga0466712_318371 Ga0466712_318371_3977_5899 640
108 3300002449 JGI24698J34947_10000645 JGI24698J34947_1000064512 641
109 3300002449 JGI24698J34947_10009242 JGI24698J34947_100092424 641
110 3300005201 Ga0072941_1011859 Ga0072941_101185913 641
111 3300042593 Ga0466691_085450 Ga0466691_085450_4495_6429 644
112 3300042594 Ga0466694_319436 Ga0466694_319436_26697_28631 644
113 3300042601 Ga0466707_038654 Ga0466707_038654_4252_6186 644
114 3300042614 Ga0466712_044599 Ga0466712_044599_10599_12533 644
115 3300042593 Ga0466691_027957 Ga0466691_027957_5254_7197 647
116 3300002450 JGI24695J34938_10022998 JGI24695J34938_100229981 648
117 3300002449 JGI24698J34947_10000233 JGI24698J34947_100002333 654

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 553 643 0.85
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 65 136 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.94 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.