Protein Family IF00288
Metagenome
104
Members
37
Samples
103
Scaffolds
244.37
Avg Length
Representative Sequence
- ID
- 3300000089|AustNasuHG_c1006463|AustNasuHG_10064631
- Length
- 268 aa
- Sequence
- MCILCLVVFDKCTINARFGELSKMSKEVIQNQYDGPRAPVKRLPTGRYNLDFAYSDNAAEIDAGIRETIKGVRLSILAMGLALAKLKDQGLYIDLKFHSMNDYLENLCDEMQIERSTAHNWLYIGEAYVKYRRELERIEFSDADGPTKLPYVDRALEIHEKRDVFKKVKEATLREFKEYAKGDEAPTPQSKIKVVGNKLYVGKKLAVTFAPELDGKTRKYLTDINVKAGEALQAGEVLYMTSLYDIEELRRFERGAEKMKKEMRVKK*
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
31.4%
Rhinotermitidae
8.6%
Termopsidae
8.6%
Unclassified
5.7%
Taxonomy
Archaea
0
Bacteria
82
Eukaryota
1
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_128142 | 3300042602 | Bacteria | 1514 |
| 2 | Ga0466720_108056 | 3300042607 | Bacteria | 7860 |
| 3 | Ga0466731_291386 | 3300042622 | Bacteria | 21593 |
| 4 | Ga0466704_443631 | 3300042643 | Bacteria | 1221 |
| 5 | Ga0466718_111365 | 3300042617 | Unclassified | 1646 |
| 6 | Ga0466728_152346 | 3300042620 | Bacteria | 3939 |
| 7 | Ga0466691_065169 | 3300042593 | Bacteria | 1373 |
| 8 | Ga0466694_100415 | 3300042594 | Bacteria | 2386 |
| 9 | JGI24698J34947_10140772 | 3300002449 | Unclassified | 1017 |
| 10 | JGI24695J34938_10013404 | 3300002450 | Bacteria | 4307 |
| 11 | JGI24695J34938_10032171 | 3300002450 | Unclassified | 2426 |
| 12 | JGI24695J34938_10134472 | 3300002450 | Bacteria | 1009 |
| 13 | Ga0072941_1000177 | 3300005201 | Bacteria | 4726 |
| 14 | Ga0466705_273506 | 3300042612 | Eukaryota | 1244 |
| 15 | Ga0466716_248578 | 3300042605 | Bacteria | 4416 |
| 16 | Ga0466720_153853 | 3300042607 | Bacteria | 34001 |
| 17 | Ga0466722_064021 | 3300042609 | Bacteria | 1846 |
| 18 | Ga0466704_326505 | 3300042643 | Unclassified | 1222 |
| 19 | Ga0466704_339196 | 3300042643 | Unclassified | 1109 |
| 20 | Ga0466704_361214 | 3300042643 | Bacteria | 5045 |
| 21 | Ga0466712_148119 | 3300042614 | Unclassified | 1073 |
| 22 | Ga0466726_246925 | 3300042619 | Bacteria | 1893 |
| 23 | Ga0466691_057393 | 3300042593 | Unclassified | 1704 |
| 24 | Ga0466694_014244 | 3300042594 | Bacteria | 29548 |
| 25 | JGI24698J34947_10001159 | 3300002449 | Bacteria | 13715 |
| 26 | Ga0072940_1231725 | 3300005200 | Unclassified | 1038 |
| 27 | Ga0466705_182625 | 3300042612 | Unclassified | 1023 |
| 28 | Ga0466722_045535 | 3300042609 | Bacteria | 7328 |
| 29 | Ga0466698_329034 | 3300042610 | Unclassified | 1076 |
| 30 | Ga0466708_235039 | 3300042652 | Bacteria | 6895 |
| 31 | Ga0466712_212910 | 3300042614 | Bacteria | 5027 |
| 32 | Ga0466718_152466 | 3300042617 | Bacteria | 1876 |
| 33 | Ga0466694_277080 | 3300042594 | Bacteria | 4472 |
| 34 | JGI24698J34947_10024648 | 3300002449 | Bacteria | 3211 |
| 35 | JGI24695J34938_10001247 | 3300002450 | Bacteria | 22361 |
| 36 | JGI24695J34938_10013652 | 3300002450 | Bacteria | 4254 |
| 37 | Ga0072940_1009798 | 3300005200 | Unclassified | 1261 |
| 38 | Ga0466705_082242 | 3300042612 | Bacteria | 3796 |
| 39 | Ga0466732_117361 | 3300042656 | Bacteria | 1642 |
| 40 | Ga0466719_194232 | 3300042606 | Bacteria | 1906 |
| 41 | Ga0466704_397120 | 3300042643 | Unclassified | 1959 |
| 42 | Ga0466704_406119 | 3300042643 | Bacteria | 4377 |
| 43 | Ga0466704_527047 | 3300042643 | Bacteria | 1363 |
| 44 | Ga0466712_067867 | 3300042614 | Bacteria | 8128 |
| 45 | Ga0466715_259082 | 3300042616 | Bacteria | 4032 |
| 46 | Ga0466718_015007 | 3300042617 | Bacteria | 6012 |
| 47 | Ga0466718_101944 | 3300042617 | Bacteria | 18573 |
| 48 | Ga0264413_147178 | 3300024493 | Unclassified | 1110 |
| 49 | Ga0466694_294285 | 3300042594 | Bacteria | 1304 |
| 50 | Ga0466696_012996 | 3300042596 | Bacteria | 1235 |
| 51 | Ga0072940_1441285 | 3300005200 | Unclassified | 941 |
| 52 | Ga0466732_031858 | 3300042656 | Bacteria | 5050 |
| 53 | Ga0466732_183584 | 3300042656 | Bacteria | 9664 |
| 54 | Ga0466707_387884 | 3300042601 | Bacteria | 1423 |
| 55 | Ga0466716_166587 | 3300042605 | Bacteria | 2963 |
| 56 | Ga0466703_269725 | 3300042636 | Bacteria | 2137 |
| 57 | Ga0466718_136630 | 3300042617 | Bacteria | 1187 |
| 58 | Ga0466726_260354 | 3300042619 | Unclassified | 2034 |
| 59 | Ga0466729_041215 | 3300042621 | Bacteria | 5929 |
| 60 | Ga0466694_026167 | 3300042594 | Bacteria | 12600 |
| 61 | Ga0072940_1085102 | 3300005200 | Bacteria | 1722 |
| 62 | Ga0072941_1000351 | 3300005201 | Bacteria | 16725 |
| 63 | Ga0466705_200266 | 3300042612 | Bacteria | 1806 |
| 64 | Ga0466735_122498 | 3300042624 | Bacteria | 2218 |
| 65 | Ga0466704_146377 | 3300042643 | Bacteria | 3568 |
| 66 | Ga0466718_001056 | 3300042617 | Bacteria | 4840 |
| 67 | Ga0466718_015605 | 3300042617 | Unclassified | 1138 |
| 68 | Ga0466692_097210 | 3300042591 | Bacteria | 1217 |
| 69 | Ga0466694_360966 | 3300042594 | Bacteria | 1543 |
| 70 | Ga0466696_101265 | 3300042596 | Bacteria | 3240 |
| 71 | JGI24698J34947_10011611 | 3300002449 | Unclassified | 4836 |
| 72 | JGI24698J34947_10093733 | 3300002449 | Bacteria | 1370 |
| 73 | Ga0072941_1000525 | 3300005201 | Bacteria | 86208 |
| 74 | Ga0466705_253495 | 3300042612 | Unclassified | 2472 |
| 75 | Ga0466707_185344 | 3300042601 | Bacteria | 1110 |
| 76 | Ga0466720_079539 | 3300042607 | Bacteria | 71236 |
| 77 | Ga0466731_236058 | 3300042622 | Bacteria | 1126 |
| 78 | Ga0466704_247192 | 3300042643 | Bacteria | 1675 |
| 79 | Ga0466704_404314 | 3300042643 | Bacteria | 22118 |
| 80 | Ga0466708_126045 | 3300042652 | Bacteria | 5744 |
| 81 | Ga0123356_10067055 | 3300010049 | Bacteria | 3361 |
| 82 | Ga0123356_10186945 | 3300010049 | Bacteria | 2099 |
| 83 | Ga0466712_247891 | 3300042614 | Unclassified | 1073 |
| 84 | Ga0466690_239981 | 3300042590 | Bacteria | 1417 |
| 85 | Ga0466692_011894 | 3300042591 | Bacteria | 12750 |
| 86 | Ga0466693_437327 | 3300042592 | Bacteria | 95896 |
| 87 | Ga0466691_198559 | 3300042593 | Bacteria | 13562 |
| 88 | Ga0466694_385107 | 3300042594 | Bacteria | 2843 |
| 89 | AustNasuHG_c1006463 | 3300000089 | Bacteria | 4179 |
| 90 | AustNasuHG_c1007377 | 3300000089 | Bacteria | 3914 |
| 91 | JGI24698J34947_10053751 | 3300002449 | Bacteria | 2014 |
| 92 | JGI24697J35500_11270886 | 3300002507 | Bacteria | 4337 |
| 93 | Ga0466732_394827 | 3300042656 | Bacteria | 3834 |
| 94 | Ga0466719_399839 | 3300042606 | Bacteria | 4443 |
| 95 | Ga0466727_207196 | 3300042655 | Bacteria | 4635 |
| 96 | Ga0466712_081409 | 3300042614 | Bacteria | 11455 |
| 97 | Ga0466690_357851 | 3300042590 | Bacteria | 1417 |
| 98 | Ga0466694_135205 | 3300042594 | Bacteria | 2762 |
| 99 | Ga0466695_006127 | 3300042595 | Bacteria | 69665 |
| 100 | Ga0466696_407544 | 3300042596 | Bacteria | 1927 |
| 101 | JGI24698J34947_10032381 | 3300002449 | Bacteria | 2746 |
| 102 | JGI24695J34938_10002833 | 3300002450 | Bacteria | 12670 |
| 103 | JGI24705J35276_12055042 | 3300002504 | Unclassified | 925 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.