Protein Family IF00004
Metagenome
Isolate
148
Members
40
Samples
141
Scaffolds
204.64
Avg Length
Representative Sequence
- ID
- 2030936001|Nasutiter_Contig41959|Nasutiterm_1951630
- Length
- 234 aa
- Sequence
- MPDTGLLRMKQKTFESVPGTNPQNFLFWLFSVLSLCYNHPMKKEFLHFDTVRNNGIKLAFRIYSDGFMPDVIYVSLRGGIYMGNVISEYFKVIHKGERPVYYAAVVAHSYIDVGKATKVRIDGWTYSPEHLRIGDKVLLIDDIFDTGRTVNTLARVILEKGIPRSDLKIAVHDYKVFVDKEEQLPIQPDYWCRKHEMSVKDEVFWIHYMSHELVGLSQAEIAENYYKQDPELKR
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
21.1%
Kalotermitidae
21.1%
Termopsidae
5.3%
Rhinotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 2 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 3 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10405654 | 3300010167 | Bacteria | 2026 |
| 2 | Ga0264413_105582 | 3300024493 | Bacteria | 13493 |
| 3 | Ga0466694_313698 | 3300042594 | Bacteria | 1065 |
| 4 | Ga0466699_114111 | 3300042597 | Bacteria | 2295 |
| 5 | Ga0466720_040642 | 3300042607 | Bacteria | 7524 |
| 6 | Nasutiter_Contig41959 | 2030936001 | Bacteria | 1405 |
| 7 | JGI24695J34938_10018283 | 3300002450 | Bacteria | 3509 |
| 8 | Ga0466735_037362 | 3300042624 | Bacteria | 1209 |
| 9 | Ga0466709_166132 | 3300042648 | Bacteria | 5359 |
| 10 | Ga0466712_052993 | 3300042614 | Unclassified | 2845 |
| 11 | Ga0466712_068910 | 3300042614 | Bacteria | 5258 |
| 12 | Ga0466712_078802 | 3300042614 | Bacteria | 3939 |
| 13 | Ga0466712_082766 | 3300042614 | Bacteria | 2759 |
| 14 | Ga0466712_112822 | 3300042614 | Bacteria | 4200 |
| 15 | Ga0466711_130644 | 3300042615 | Bacteria | 3051 |
| 16 | Ga0466715_096853 | 3300042616 | Bacteria | 12428 |
| 17 | Ga0123356_10001810 | 3300010049 | Bacteria | 23294 |
| 18 | Ga0123353_10532940 | 3300010167 | Bacteria | 1699 |
| 19 | Ga0123353_11311046 | 3300010167 | Bacteria | 939 |
| 20 | Ga0466693_152830 | 3300042592 | Bacteria | 52782 |
| 21 | Ga0466720_195450 | 3300042607 | Bacteria | 5334 |
| 22 | AustNasuHG_c1000146 | 3300000089 | Bacteria | 22298 |
| 23 | AustNasuHG_c1051716 | 3300000089 | Bacteria | 871 |
| 24 | JGI24698J34947_10009343 | 3300002449 | Unclassified | 5382 |
| 25 | JGI24698J34947_10105758 | 3300002449 | Bacteria | 1254 |
| 26 | JGI24695J34938_10000507 | 3300002450 | Bacteria | 37871 |
| 27 | Ga0072941_1015770 | 3300005201 | Bacteria | 12849 |
| 28 | Ga0072941_1462723 | 3300005201 | Bacteria | 1021 |
| 29 | Ga0466703_022665 | 3300042636 | Bacteria | 14111 |
| 30 | Ga0466703_152439 | 3300042636 | Bacteria | 3179 |
| 31 | Ga0466712_227758 | 3300042614 | Bacteria | 1038 |
| 32 | Ga0466718_062558 | 3300042617 | Bacteria | 1034 |
| 33 | Ga0466732_000981 | 3300042656 | Bacteria | 2916 |
| 34 | Ga0466732_055687 | 3300042656 | Bacteria | 10571 |
| 35 | Ga0123356_10182795 | 3300010049 | Bacteria | 2120 |
| 36 | Ga0264413_104683 | 3300024493 | Bacteria | 11057 |
| 37 | Ga0264413_106988 | 3300024493 | Unclassified | 7559 |
| 38 | Ga0264413_115211 | 3300024493 | Unclassified | 1026 |
| 39 | Ga0466694_269963 | 3300042594 | Bacteria | 1122 |
| 40 | Ga0466699_037483 | 3300042597 | Bacteria | 31779 |
| 41 | Ga0466699_057580 | 3300042597 | Bacteria | 3155 |
| 42 | Ga0466699_153302 | 3300042597 | Bacteria | 9520 |
| 43 | Ga0466700_442872 | 3300042600 | Bacteria | 2165 |
| 44 | Ga0466720_231517 | 3300042607 | Bacteria | 12237 |
| 45 | Ga0466722_228641 | 3300042609 | Bacteria | 7621 |
| 46 | JGI24698J34947_10002770 | 3300002449 | Bacteria | 9487 |
| 47 | JGI24698J34947_10030891 | 3300002449 | Bacteria | 2823 |
| 48 | Ga0072941_1077041 | 3300005201 | Bacteria | 2096 |
| 49 | Ga0466730_053807 | 3300042625 | Bacteria | 1107 |
| 50 | Ga0466702_239754 | 3300042635 | Bacteria | 3230 |
| 51 | Ga0466704_099514 | 3300042643 | Bacteria | 6163 |
| 52 | Ga0466715_043809 | 3300042616 | Bacteria | 8373 |
| 53 | Ga0466694_028192 | 3300042594 | Bacteria | 14782 |
| 54 | Ga0466716_195783 | 3300042605 | Bacteria | 5547 |
| 55 | Ga0466720_053558 | 3300042607 | Bacteria | 15544 |
| 56 | JGI24698J34947_10001751 | 3300002449 | Bacteria | 11564 |
| 57 | JGI24698J34947_10175382 | 3300002449 | Bacteria | 863 |
| 58 | JGI24695J34938_10001566 | 3300002450 | Bacteria | 19253 |
| 59 | JGI24695J34938_10003317 | 3300002450 | Bacteria | 11339 |
| 60 | JGI24697J35500_11187499 | 3300002507 | Bacteria | 1562 |
| 61 | Ga0072941_1088203 | 3300005201 | Bacteria | 3176 |
| 62 | Ga0466735_204600 | 3300042624 | Bacteria | 4609 |
| 63 | Ga0466712_186952 | 3300042614 | Bacteria | 20411 |
| 64 | Ga0466732_271304 | 3300042656 | Bacteria | 13044 |
| 65 | Ga0466732_438014 | 3300042656 | Bacteria | 2524 |
| 66 | Ga0264413_100122 | 3300024493 | Bacteria | 35376 |
| 67 | Ga0466694_115287 | 3300042594 | Bacteria | 6353 |
| 68 | Ga0466699_040504 | 3300042597 | Bacteria | 8134 |
| 69 | Ga0466700_245726 | 3300042600 | Bacteria | 1358 |
| 70 | Ga0466720_119259 | 3300042607 | Bacteria | 3532 |
| 71 | Ga0466720_148662 | 3300042607 | Bacteria | 4275 |
| 72 | Ga0466720_217425 | 3300042607 | Bacteria | 21579 |
| 73 | Ga0466722_067302 | 3300042609 | Bacteria | 6327 |
| 74 | Ga0466722_098279 | 3300042609 | Bacteria | 16423 |
| 75 | Ga0466698_026377 | 3300042610 | Bacteria | 1259 |
| 76 | JGI24695J34938_10013416 | 3300002450 | Bacteria | 4304 |
| 77 | Ga0072941_1071768 | 3300005201 | Bacteria | 1859 |
| 78 | Ga0466702_072470 | 3300042635 | Bacteria | 1090 |
| 79 | Ga0466702_231024 | 3300042635 | Bacteria | 9050 |
| 80 | Ga0466702_309366 | 3300042635 | Unclassified | 2332 |
| 81 | Ga0466712_002198 | 3300042614 | Bacteria | 2703 |
| 82 | Ga0466712_155540 | 3300042614 | Bacteria | 10157 |
| 83 | Ga0466718_131846 | 3300042617 | Bacteria | 4297 |
| 84 | Ga0466726_256354 | 3300042619 | Bacteria | 1163 |
| 85 | Ga0466728_070228 | 3300042620 | Bacteria | 9479 |
| 86 | Ga0466732_157037 | 3300042656 | Bacteria | 6440 |
| 87 | Ga0264413_100247 | 3300024493 | Bacteria | 36643 |
| 88 | Ga0466694_106168 | 3300042594 | Bacteria | 2476 |
| 89 | Ga0466694_315626 | 3300042594 | Bacteria | 5472 |
| 90 | Ga0466720_030290 | 3300042607 | Unclassified | 12839 |
| 91 | Ga0466720_032077 | 3300042607 | Bacteria | 7506 |
| 92 | Ga0466720_065666 | 3300042607 | Unclassified | 2932 |
| 93 | AustNasuHG_c1021062 | 3300000089 | Bacteria | 2116 |
| 94 | JGI24698J34947_10019362 | 3300002449 | Bacteria | 3671 |
| 95 | JGI24698J34947_10182131 | 3300002449 | Bacteria | 839 |
| 96 | Ga0466708_132767 | 3300042652 | Bacteria | 13186 |
| 97 | Ga0466708_159818 | 3300042652 | Bacteria | 12071 |
| 98 | Ga0466711_142487 | 3300042615 | Bacteria | 22824 |
| 99 | Ga0466694_070857 | 3300042594 | Bacteria | 2302 |
| 100 | Ga0466694_131064 | 3300042594 | Bacteria | 6240 |
| 101 | Ga0466694_296639 | 3300042594 | Unclassified | 6605 |
| 102 | Ga0466699_290256 | 3300042597 | Bacteria | 2571 |
| 103 | Ga0466720_002785 | 3300042607 | Bacteria | 44479 |
| 104 | Ga0466720_025415 | 3300042607 | Bacteria | 22188 |
| 105 | Ga0466720_162399 | 3300042607 | Bacteria | 19296 |
| 106 | Ga0466720_225493 | 3300042607 | Bacteria | 4098 |
| 107 | Ga0466698_263796 | 3300042610 | Bacteria | 1505 |
| 108 | Ga0466698_311604 | 3300042610 | Bacteria | 1608 |
| 109 | AustNasuHG_c1035803 | 3300000089 | Unclassified | 1301 |
| 110 | AustNasuHG_c1040444 | 3300000089 | Bacteria | 1139 |
| 111 | JGI24698J34947_10038738 | 3300002449 | Bacteria | 2471 |
| 112 | JGI24698J34947_10054189 | 3300002449 | Bacteria | 2004 |
| 113 | JGI24698J34947_10155247 | 3300002449 | Bacteria | 944 |
| 114 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 115 | JGI24695J34938_10006466 | 3300002450 | Bacteria | 7028 |
| 116 | Ga0466718_067357 | 3300042617 | Bacteria | 7791 |
| 117 | Ga0466718_075443 | 3300042617 | Bacteria | 17626 |
| 118 | Ga0466718_101944 | 3300042617 | Bacteria | 18573 |
| 119 | Ga0466728_051073 | 3300042620 | Bacteria | 12284 |
| 120 | Ga0123356_10550298 | 3300010049 | Bacteria | 1315 |
| 121 | Ga0123356_11600995 | 3300010049 | Bacteria | 806 |
| 122 | Ga0264413_103647 | 3300024493 | Bacteria | 10362 |
| 123 | Ga0264413_109451 | 3300024493 | Unclassified | 2079 |
| 124 | Ga0264413_115144 | 3300024493 | Bacteria | 10419 |
| 125 | Ga0466699_189531 | 3300042597 | Bacteria | 15863 |
| 126 | Ga0466707_373814 | 3300042601 | Bacteria | 5293 |
| 127 | Ga0466720_117570 | 3300042607 | Bacteria | 11786 |
| 128 | JGI24698J34947_10023759 | 3300002449 | Bacteria | 3278 |
| 129 | JGI24698J34947_10024350 | 3300002449 | Bacteria | 3232 |
| 130 | JGI24698J34947_10039148 | 3300002449 | Bacteria | 2456 |
| 131 | JGI24698J34947_10125132 | 3300002449 | Bacteria | 1109 |
| 132 | JGI24695J34938_10000723 | 3300002450 | Bacteria | 31147 |
| 133 | JGI24695J34938_10028391 | 3300002450 | Bacteria | 2630 |
| 134 | Ga0072940_1085097 | 3300005200 | Unclassified | 817 |
| 135 | Ga0072940_1085098 | 3300005200 | Unclassified | 1418 |
| 136 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
| 137 | Ga0072941_1088202 | 3300005201 | Bacteria | 4130 |
| 138 | Ga0466712_052764 | 3300042614 | Bacteria | 4869 |
| 139 | Ga0466718_032984 | 3300042617 | Bacteria | 3088 |
| 140 | Ga0466718_122551 | 3300042617 | Bacteria | 2024 |
| 141 | Ga0466718_135229 | 3300042617 | Bacteria | 9174 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 54 | 163 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.