| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300034631 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0141841 | Gp0396392 | Ga0370539 |
| Sample Name | Soil microbial communities from Atacama Desert, Chile - 20181212_24i |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 92017551 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Terrestrial Microbial Communities From Various Environments And Locations |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Terrestrial Microbial Communities From Various Environments And Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | desert biome → desert → surface soil |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Chile: Atacama Region | |||||||
| Coordinates | Lat. (o) | -26.1119 | Long. (o) | -70.6479 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001230 | Metagenome / Metatranscriptome | 741 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0370539_17284 | Not Available | 711 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0370539_17284 | Ga0370539_17284_510_710 | F001230 | MPATADEAVRNAHAWFEHNSGWAPPDEDTLAEWVADGVCRCPDECLVAPDGWCEHGLASWALILAAL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |