


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300033446 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0129088 | Gp0344147 | Ga0316611 |
| Sample Name | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.202 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 314944902 |
| Sequencing Scaffolds | 14 |
| Novel Protein Genes | 17 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electronema → unclassified Candidatus Electronema → Candidatus Electronema sp. GS | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon llansteffanensis | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| All Organisms → cellular organisms → Bacteria | 4 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → sinkhole → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 45.1993 | Long. (o) | -83.3279 | Alt. (m) | N/A | Depth (m) | 185 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002525 | Metagenome / Metatranscriptome | 552 | Y |
| F044511 | Metagenome / Metatranscriptome | 154 | Y |
| F079740 | Metagenome / Metatranscriptome | 115 | Y |
| F084884 | Metagenome / Metatranscriptome | 112 | Y |
| F095378 | Metagenome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0316611_1008386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electronema → unclassified Candidatus Electronema → Candidatus Electronema sp. GS | 3266 | Open in IMG/M |
| Ga0316611_1013526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2517 | Open in IMG/M |
| Ga0316611_1020407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1987 | Open in IMG/M |
| Ga0316611_1026943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon llansteffanensis | 1688 | Open in IMG/M |
| Ga0316611_1033778 | Not Available | 1473 | Open in IMG/M |
| Ga0316611_1033823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1471 | Open in IMG/M |
| Ga0316611_1057536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1042 | Open in IMG/M |
| Ga0316611_1059832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1015 | Open in IMG/M |
| Ga0316611_1062399 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| Ga0316611_1063187 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| Ga0316611_1067314 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| Ga0316611_1085373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 792 | Open in IMG/M |
| Ga0316611_1086586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium | 784 | Open in IMG/M |
| Ga0316611_1111554 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0316611_1008386 | Ga0316611_10083863 | F002525 | VWAGVDSVWEQEKLEARKMLENAAESHTSGARFVRRG |
| Ga0316611_1013526 | Ga0316611_10135261 | F044511 | SGQQAGCLTKRAPDAGDSGAIPSLFLRLSIFPIGRRSAARPSAGNANR |
| Ga0316611_1020407 | Ga0316611_10204071 | F084884 | PTLGILARFQAFFYASAFFQSDGVPPPAPARVTQTVGTPLAKLVKSKRD |
| Ga0316611_1026445 | Ga0316611_10264454 | F079740 | MRTQVISFPNKQTLCVFPDKPSDLEQAISELKLDGNSPVIVLIGGVIDKQQAEATRQ |
| Ga0316611_1026943 | Ga0316611_10269432 | F044511 | KHKRQPTKRAPDAGDSAAFSSLFLRLSLFPVGRRSAAHPSAGNANR |
| Ga0316611_1033778 | Ga0316611_10337783 | F095378 | MKAILIDELVKYQSTTEQVSVTIEGKKLEGWEIAKPLNYEKKYTRFTDRLKSSIKVLTGKAIAVQFFTDLTEQDKIAYVKTKLN |
| Ga0316611_1033823 | Ga0316611_10338233 | F044511 | KRAPDAGDSGAIPSIFLRLSIFPVGRRSAARPSAGNANR |
| Ga0316611_1057536 | Ga0316611_10575363 | F002525 | VWAGVDNVWEQENAEARKMLENAAESHTSGARFVG |
| Ga0316611_1059832 | Ga0316611_10598321 | F002525 | NVWKREKLEARKLLENRAESPASGARFVRRGFIHQVLVR |
| Ga0316611_1062399 | Ga0316611_10623992 | F084884 | TLGILARFQAFFYALSFSQSDGVPPPAPARVTQTVVPLL |
| Ga0316611_1063187 | Ga0316611_10631873 | F084884 | VHPTLGILARFQAFFYASAFFQSDGVPPPAPARVTQAVGHFLAE |
| Ga0316611_1067314 | Ga0316611_10673143 | F084884 | LGILARFQAFFYASAFSQSDGVPPPAPARVTQTVGRFLAQPK |
| Ga0316611_1067810 | Ga0316611_10678102 | F079740 | MRTQKIYFPDQQEVLCVFPNKRSNLEQAISELRLGGNY |
| Ga0316611_1085373 | Ga0316611_10853731 | F084884 | LGILARFQAFFYALSFSQSDGVPPPDPARVTQTVGQFLAKHH |
| Ga0316611_1086586 | Ga0316611_10865861 | F084884 | GILARFQAFFYASAFFQSDGVPPPAPARVTQTVSP |
| Ga0316611_1111554 | Ga0316611_11115542 | F084884 | VHPTLGILARFQAFFYASTFSQSDGVPPPTPARVTQTVRQIFGEIDL |
| Ga0316611_1158904 | Ga0316611_11589041 | F079740 | MRTKKISFPGQQSLCVFPNNRSELAQAISELHLNGNSPVIVLIGGEIDEKEAEATHRA |
| ⦗Top⦘ |