| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300031953 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133511 | Gp0330634 | Ga0314855 |
| Sample Name | Cryopeg brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 CB1W |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22202352 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hydrotalea → unclassified Hydrotalea → Hydrotalea sp. AMD | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Extreme Environments Viral Communities From Various Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Cryopeg Brine → Extreme Environments Viral Communities From Various Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → area of sea ice → brine |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 71.2943 | Long. (o) | -156.7153 | Alt. (m) | N/A | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035569 | Metagenome | 172 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0314855_103160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hydrotalea → unclassified Hydrotalea → Hydrotalea sp. AMD | 1288 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0314855_103160 | Ga0314855_1031605 | F035569 | MNKHEKLIEMMRITGKGKMACEICLQLCGYDMEKTLERMQRSYPSMEVKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |