| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300031914 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0135173 | Gp0347961 | Ga0326478 |
| Sample Name | Enriched hypersaline water microbial communities from Club Lake, Antarctica - Round 2 flow cytometry Nha-CFC |
| Sequencing Status | Permanent Draft |
| Sequencing Center | The University of Queensland |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 34916470 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Antarctic Nanohaloarchaea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Antarctic Nanohaloarchaea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hypersaline lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Club Lake, Antarctica | |||||||
| Coordinates | Lat. (o) | -68.5417 | Long. (o) | 78.2467 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047394 | Metagenome | 150 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0326478_101093 | Not Available | 3654 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0326478_101093 | Ga0326478_1010932 | F047394 | MTASTQPTETRAQTTNGSFQTDVSALQEMTERAVEILDSHGEPVTIARLVGTVVRLGARDEYRFETTVRVAQQYIDEECGGVDR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |