NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031504

3300031504: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R6 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031504 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0132857 | Gp0330683 | Ga0314821
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R6 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17656113
Sequencing Scaffolds4
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → land → biofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001633Metagenome / Metatranscriptome660Y
F013934Metagenome / Metatranscriptome267Y
F017067Metagenome / Metatranscriptome243Y
F053640Metagenome / Metatranscriptome141Y
F068522Metagenome / Metatranscriptome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314821_104083All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei836Open in IMG/M
Ga0314821_104139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae831Open in IMG/M
Ga0314821_105650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
Ga0314821_111415Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314821_102976Ga0314821_1029761F068522MRVPRSARVPIQPRTIVRIGRRVALAALAVTMSVSFGLHSTAYAQDSESSGRTHSLGVNLDFPDDGLVDSEQLCVALFSGTSPDLQKPPLLSRCIDPGADAVTFEGLRPGDFSVLLPGPGSDVEGQRYEGQLVTTNIPDDEQLDAFGIDINVGLSPEFTGTTGSVQVSVFGCPAGTNAGADKDSWVNECKSLAGGVPMTLTGIGSINDAAFQKVTGVSGNASGMVEFTDLPAGAYEIGGVLPANVSDSPALFAESSIDGSLGAIEPSESLALRPTETVAVDVFLVLDDTPDSATTVGTTDLEI
Ga0314821_104083Ga0314821_1040831F001633GANLWGWAFVTRSFPAAHAWTRSLFAGGVLPDATLRGMRMFRSHGGTVLTVAGRELSSEASAPGSDAPCRERRAGRGVDTPATFIFRVGTFYRGVGISLWLIVGPALRV
Ga0314821_104139Ga0314821_1041391F053640LDRTVAAQRSEMVAESTTGIIPGDRGKAGGNWCRPPLMPAKAVMRHISPVPLAGVVSGQSTHELGTEPQGAIRNRVEWSQATQGVSTCASTQLPQRLRLLLRRPERHRVSRRDDPAKRPHSPHEWGAQGTYGGGERTDLGKVREPPHRGGVKHTSPSCKRQRSLRGKRSDP
Ga0314821_104139Ga0314821_1041392F001633QLVGVGVRHTLFPGGTYLDALAFAGDVLPDATLHGMRMFRSHGGTVLTVAGRDLSSEASAPGSDAPCRERRAGRGADTPATFIFARRHPYHGDGTGLWPVVGPALRV
Ga0314821_105650Ga0314821_1056502F017067MPFWLARKAAPHVWKRVPWAKVWVVTLWLLKKGRDRIERNLTQREQTEFWNLLKKSKGRPDNLTKRDRTRVKHLVGKAI
Ga0314821_111415Ga0314821_1114151F013934DKANIERIHLLLKRHEQMIEEKKLNPEEFLRQNEPFQEAFGRMARSTIVPILEEIKDILVGKVESASIFHKRTAAGLRVKLDRWEDFERSLLFFGDASTQTVRVTHEGVGFGLLSQKLGLQNVTPELVEEEAMKFLRRLFGQEQLRRPAHTPETADRRRAPSSPFAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.