NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031488

3300031488: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031488 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132857 | Gp0330666 | Ga0314804
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_N_R1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size16459993
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandbiofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079646Metagenome / Metatranscriptome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314804_104290All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes917Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314804_104290Ga0314804_1042901F079646MLAAAMAVVPSAASAQTSGKWLATISQIPTVGGSADLTVEPRNDKQSRAKITFRNGGRDRRIAWDIVVGRCRDDGLAIAPQATFTQVQTQMDGSGTASANIPKLEPGKMYYVRVFDPQSPASDATAYACANLSEKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.