NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031372

3300031372: Leaf surface microbial communities from wheat plants in UC Gill Tract Community Farm, Albany, California, United States - DLSL W.R1 (v2)



Overview

Basic Information
IMG/M Taxon OID3300031372 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133512 | Gp0294697 | Ga0302347
Sample NameLeaf surface microbial communities from wheat plants in UC Gill Tract Community Farm, Albany, California, United States - DLSL W.R1 (v2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size435636554
Sequencing Scaffolds0
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLeaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Leaf Surface → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant surface

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081732Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link

Sequences

Scaffold IDProtein IDFamilySequence
Ga0302347_1075986Ga0302347_10759862F081732GLVLNILKKLKGLKFIFPSASIVEAKQIGRGAMAYCR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.