x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300031112
3300031112: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2
Overview
Basic Information
IMG/M Taxon OID 3300031112 Open in IMG/M GOLD Reference Gs0133512 | Gp0324012 | Ga0308156 Sample Name Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2 Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 536023527 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States Type Host-Associated Taxonomy Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Unclassified
Location Information
Location USA: California Coordinates Lat. (o ) 37.8864 Long. (o ) -122.2981 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F060965 Metagenome / Metatranscriptome 132 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0308156_1117197 All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae 768 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0308156_1117197 Ga0308156_11171973 F060965 CWWLGTLTPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD
