NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031112

3300031112: Phyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2



Overview

Basic Information
IMG/M Taxon OID3300031112 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133512 | Gp0324012 | Ga0308156
Sample NamePhyllosphere microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSL A.R2
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size536023527
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameLeaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060965Metagenome / Metatranscriptome132Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0308156_1117197All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae768Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0308156_1117197Ga0308156_11171973F060965CWWLGTLTPAIRAIRYSSKLTLTLLVTRLDADHTDHALALDDLAVAADPLD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.