NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030665

3300030665: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 4_T1E_3DKB8 developmental time series (Eukaryote Community Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300030665 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128996 | Gp0213221 | Ga0187729
Sample NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 4_T1E_3DKB8 developmental time series (Eukaryote Community Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71531779
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002609Metagenome / Metatranscriptome543Y
F004023Metagenome / Metatranscriptome456Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187729_1003824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium811Open in IMG/M
Ga0187729_1107174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea562Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187729_1003824Ga0187729_10038241F002609VLEHNRHHASTVDLLIQGEFGWDPEEFHYALQQWAGPWSSNWYKYLLTVPFIPVIHFFGLNDTGSLFALEWWMHFPDEGAGGKCNKEFWSKWIPRRVKHNAFVLSLWACVWLLGTYPLGRPLSEGWRFMFTVSVFARIGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNVMAMVLGGKHRWNEMLFHDVHHAFPNAVGTLSQRGRFHGWEKVHDAAAEVLHRGLWKPNGDEETQMQKTQKKRSMMMKQGK
Ga0187729_1107174Ga0187729_11071741F004023FTDKQLNTDTFIRLAYGHYLIAFYMAYLGLIHGIDMHYDXKNETTFDGLDTEMVXXDEALSNELGHMTDVLIIIAFVCXFMYAEPEALSYEIFMXGDIGIVTDVRFYGVAPHXYFRPFMAXLIACPYHKVGIFGLLFFFFVLFFQPALHGTSEQNNYNKRVLLFVKQKLGRSNMISASYFNLEMNIY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.