NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030664

3300030664: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 5_T1F_3DKB8 developmental time series (Eukaryote Community Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300030664 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128996 | Gp0213222 | Ga0187730
Sample NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 5_T1F_3DKB8 developmental time series (Eukaryote Community Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size51027088
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004725Metagenome / Metatranscriptome426Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187730_103909Not Available611Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187730_103909Ga0187730_1039091F004725LEVKPTFQFSAAIVPMATSAPLLGKQGKAAHSKASIFYGADEYLEELKKKYEHDHEIAALKNALPGEGDPNAAGVAQSNDKMLSVQKNDENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFFTQVLMVIGYCAALATFPDYWWTCTLCFGLPFSYIAIQNIYIDHDVMHGATFPVYEWQRFLTHPFAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.