NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300030649

3300030649: Metatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 8_T1F_8DKB8 developmental time series (Eukaryote Community Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300030649 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128996 | Gp0213225 | Ga0187733
Sample NameMetatranscriptome of Jellyfish Cassiopea xamachana and symbiotic dinoflagellate Symbiodinium from Pennsylvania, USA - 8_T1F_8DKB8 developmental time series (Eukaryote Community Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size45765995
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Upside-down Jellyfish Cassiopea Xamachana Infected With Symbiotic Dinoflagellate Symbiodinium From Hawaii, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7982Long. (o)-77.8599Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037503Metagenome / Metatranscriptome168Y
F074901Metatranscriptome119N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0187733_107900Not Available648Open in IMG/M
Ga0187733_116485All Organisms → cellular organisms → Bacteria620Open in IMG/M
Ga0187733_141286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata829Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0187733_107900Ga0187733_1079001F037503MEVELPIGLGGFTAYQPLMNSECHYTAAAVRQWVLRSIAKRGTTQTIG
Ga0187733_116485Ga0187733_1164852F037503LELPEMHLGAASVMSVMEVELPIRLGGFTAYQPLMNSECHDTALAVRQWVRRSIAKRERTQTIS
Ga0187733_141286Ga0187733_1412861F074901YLEELKKKYEHDHEIAALKNALPGEGDPNAAGVAQSNDKMLSVQKNAENRSLKTNRLFPTPNKPDPMPQNLAFLFTKITPEQMIYMWNVLTAIFFSQVLMVIGYCAALACFPDYWWTCTLCFGIPFSYIAIQNIYIDHDVMHGATFPVYEWQRFLTHPFADFFSLPWEEFVLEHNRHHASTVDLLIQGEFGWDPEEFHYALQQWAGPWGSNWYKYLLTVPFIPVIHFFGLNDTGSLFALEWWMHFPDEGAGGKCNKEFWSKWIPRRIKHNAFVLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.