NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029936

3300029936: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92206



Overview

Basic Information
IMG/M Taxon OID3300029936 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118585 | Gp0137268 | Ga0119925
Sample NameActivated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92206
Sequencing StatusPermanent Draft
Sequencing CenterCalifornia Institute of Technology
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31672081
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
Not Available2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameActivated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
TypeEngineered
TaxonomyEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationAustralia: Queensland
CoordinatesLat. (o)-27.49999Long. (o)153.01209Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002371Metagenome / Metatranscriptome566Y
F013948Metagenome / Metatranscriptome267Y
F083890Metagenome / Metatranscriptome112Y
F095570Metagenome / Metatranscriptome105Y
F100051Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119925_100279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9864Open in IMG/M
Ga0119925_103507Not Available1210Open in IMG/M
Ga0119925_104743All Organisms → cellular organisms → Bacteria968Open in IMG/M
Ga0119925_106564Not Available765Open in IMG/M
Ga0119925_107928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119925_100279Ga0119925_10027912F013948MREKLKKIVAYIFRSWEDEPGHTHPRLKILPPFLLELLAYLIGLAILYQIGAYLWSII
Ga0119925_103507Ga0119925_1035072F002371MKNKQETRGGTRKKAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK
Ga0119925_104743Ga0119925_1047433F100051MLERLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG
Ga0119925_106564Ga0119925_1065643F083890LTAAKTPAQRQAERKARELAAGRVQWKRWVHPDDVPALAEYADKLARKRARAEQKAG
Ga0119925_107928Ga0119925_1079281F095570LYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.