Basic Information | |
---|---|
IMG/M Taxon OID | 3300029929 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118588 | Gp0137292 | Ga0119938 |
Sample Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Treated_water_201207 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hong Kong |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 9891232 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1 |
All Organisms → Viruses → Predicted Viral | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater biome → water treatment plant → drinking water |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | ||||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000325 | Metagenome / Metatranscriptome | 1296 | Y |
F074795 | Metagenome | 119 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119938_10474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1318 | Open in IMG/M |
Ga0119938_10570 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119938_10474 | Ga0119938_104743 | F074795 | VTKEQAIIKILKVLKSPMMVMNVYNRDEALTLAEEYGITAKDLIEEWTRIAERI |
Ga0119938_10570 | Ga0119938_105703 | F000325 | MKVANGNDKLGKGCLVVSRPVGDTCPSSCAFLGNGCYAEQTEKMYPNVRPAGLQNVITEKNRIRAMILDAVRQGKSIRWHERGDWFLNGTLDTDYVSNVTDACESILASGGTLPDMWFYTHIYDSRLVSLEKYMAVYASVHNAADKAAAVAAGFKLFAWCDSDTKIAPKRPKRKAAADAWRNSLPKLVVIDDTKY |
⦗Top⦘ |