| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029929 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118588 | Gp0137292 | Ga0119938 |
| Sample Name | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Treated_water_201207 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hong Kong |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9891232 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant → Freshwater Microbial Communities From Drinking Water Treatment Plant - The University Of Hong Kong |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater biome → water treatment plant → drinking water |
| Earth Microbiome Project Ontology (EMPO) | Unclassified |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000325 | Metagenome / Metatranscriptome | 1296 | Y |
| F074795 | Metagenome | 119 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0119938_10474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1318 | Open in IMG/M |
| Ga0119938_10570 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0119938_10474 | Ga0119938_104743 | F074795 | VTKEQAIIKILKVLKSPMMVMNVYNRDEALTLAEEYGITAKDLIEEWTRIAERI |
| Ga0119938_10570 | Ga0119938_105703 | F000325 | MKVANGNDKLGKGCLVVSRPVGDTCPSSCAFLGNGCYAEQTEKMYPNVRPAGLQNVITEKNRIRAMILDAVRQGKSIRWHERGDWFLNGTLDTDYVSNVTDACESILASGGTLPDMWFYTHIYDSRLVSLEKYMAVYASVHNAADKAAAVAAGFKLFAWCDSDTKIAPKRPKRKAAADAWRNSLPKLVVIDDTKY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |