NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029818

3300029818: Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2699



Overview

Basic Information
IMG/M Taxon OID3300029818 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133313 | Gp0288070 | Ga0246095
Sample NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2699
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of California, Berkeley
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size148821655
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomeplanetary subsurface zonegroundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)N/ADepth (m)215
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072481Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0246095_102133All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens9850Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0246095_102133Ga0246095_10213311F072481MLLRLKSNLFGIMIPGSKQSEDMKSRKEGTIPPFHPNLKSEKHVSCKHCGETYKENEIKRDPKSGEWVCKHYPKCEGTGWHSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.