


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029785 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133117 | Gp0282924 | Ga0243763 |
| Sample Name | Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_31_stool_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 247388828 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Baltimore | |||||||
| Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055715 | Metagenome | 138 | N |
| F067845 | Metagenome | 125 | N |
| F070093 | Metagenome | 123 | N |
| F087334 | Metagenome | 110 | N |
| F089053 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0243763_1002374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 17760 | Open in IMG/M |
| Ga0243763_1003019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 14316 | Open in IMG/M |
| Ga0243763_1015799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2409 | Open in IMG/M |
| Ga0243763_1027252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1272 | Open in IMG/M |
| Ga0243763_1062553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0243763_1002374 | Ga0243763_10023743 | F087334 | MASRSPFVGAAVHLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLYRAAALFGYREKHP |
| Ga0243763_1003019 | Ga0243763_100301916 | F055715 | LTKANEFDKINELLIERTAKKLKKLQKKFLTNEKLCGKINELIRVGAAKILDN |
| Ga0243763_1015799 | Ga0243763_10157991 | F070093 | SNFESLLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPKSTQTLS |
| Ga0243763_1027252 | Ga0243763_10272522 | F067845 | MKHWKNLLVCLLAGVLALGVLTACSGLGSVNTGTDAEKAAELAQQLGVVHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALNADNNMSHTDDLNAFLYWSGCYGVPDDVTVALLLDDSTAMTAQLYAPQADSAAAKLLEDAAGHNEMGAAFIDYNGAAYVVAVFR |
| Ga0243763_1062553 | Ga0243763_10625533 | F089053 | AFSVKLERVVDGCRPVKGCIRKWIYRSANGQPELSTAEEATVKNMEAFL |
| ⦗Top⦘ |