| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029651 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0128792 | Gp0307469 | Ga0268362 |
| Sample Name | Soil microbial communities from Anza Borrego Desert, Southern California, United States - Methanotrophic co-culture R2-M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 22386889 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | desert biome → desert → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: California | |||||||
| Coordinates | Lat. (o) | 33.0544457 | Long. (o) | -116.3577702 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001736 | Metagenome / Metatranscriptome | 644 | Y |
| F037757 | Metagenome / Metatranscriptome | 167 | Y |
| F076629 | Metagenome / Metatranscriptome | 118 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0268362_102147 | Not Available | 925 | Open in IMG/M |
| Ga0268362_102976 | Not Available | 778 | Open in IMG/M |
| Ga0268362_103713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 693 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0268362_102147 | Ga0268362_1021471 | F076629 | VIRTATVYALVVLSLAAARPAFSYSLVSLEPNERTHMLTTCGRLPGNDQALCRSVVDDSRVIANYKRSCLHAMTLLLKGTAWDAVKSLPATLTCREGLGKAGYPVKDIMKRLTGGG |
| Ga0268362_102976 | Ga0268362_1029761 | F037757 | VLNTALRRNTPFWISILIGLAIWEIAGRSTSAAFMVPFSTTMVRLWQLVAGGSFLTQFLDSAVLFLTGFVLAV |
| Ga0268362_103713 | Ga0268362_1037131 | F001736 | MPEGYRRPHIHERVQTVERMRRAWEAEQDALATVREFNARLSSNRAVWAWPKVTAAMTAKHPWVSIMCDSCGGITDMDLRMKPRDPEASVRVVLRDVRCPRCNGHGRPRIIGLTQLPST |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |