


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029297 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121305 | Gp0151713 | Ga0134541 |
| Sample Name | Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hong Kong |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 215950181 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.3356 | Long. (o) | 114.1826 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099451 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134541_1001654 | Not Available | 11132 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134541_1001654 | Ga0134541_100165423 | F099451 | MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE |
| ⦗Top⦘ |