| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029242 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127417 | Gp0192528 | Ga0168113 |
| Sample Name | Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP1 - Uppsala-primary/surplus 102 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Gothenburg |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 131296493 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sweden | |||||||
| Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041480 | Metagenome | 160 | Y |
| F088774 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0168113_1029205 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 951 | Open in IMG/M |
| Ga0168113_1054851 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0168113_1029205 | Ga0168113_10292052 | F041480 | LGLKGAKQLLSMDAASSKIRFVAKKDIVFFIKTSGDVIDLTSYIKLYEFVPVGQKREVTVTTKEGMLNNKEEAIGRLISFSVKMISKDNYQIQLPEQLAAGEYGFVWVKNMELKEFTVFAFGIDWKSSD |
| Ga0168113_1054851 | Ga0168113_10548512 | F088774 | VGHTVQADAKFLRRVLLGLVFLTLVTGGMAGLTTVQAKSEAAGRCVVLCQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |