NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028485

3300028485: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C36



Overview

Basic Information
IMG/M Taxon OID3300028485 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116274 | Gp0272168 | Ga0233365
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C36
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size260506115
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003605Metagenome / Metatranscriptome477Y
F051619Metagenome / Metatranscriptome143Y
F060691Metagenome / Metatranscriptome132Y
F086058Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233365_1000110Not Available43119Open in IMG/M
Ga0233365_1094475Not Available623Open in IMG/M
Ga0233365_1096198Not Available616Open in IMG/M
Ga0233365_1097892All Organisms → cellular organisms → Bacteria608Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0233365_1000110Ga0233365_100011051F003605VAVGDQAQAAGFPLVPDTGEEGRVRWGGREINRTRDLIAAVKALLPIGKPGYRTASGISTGTADPTGGVDGDIYFKILD
Ga0233365_1094475Ga0233365_10944751F060691MLMAVEGMDPTLKMIFFAAAVVLFALAAIGYSRGKVSFLAAGLAAFAIPFFWDALAAS
Ga0233365_1096198Ga0233365_10961982F051619MNNDINWTQVRIDASINIMNAILSSSIMVFIFQFIFKKQIADIAVEYADKLVE
Ga0233365_1097892Ga0233365_10978922F086058RKVGGSSMTTYRAYRVDSRRHIQSAAWLDAPNDAAARAKAAELCDEGTPAVELWQATRLVDEIECADEEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.