x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300028441
3300028441: Soil microbial communities from Anza Borrego Desert, Southern California, United States - Bradyrhizobium sp. S3-V5C
Overview
| Basic Information |
| IMG/M Taxon OID | 3300028441 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0128792 | Gp0307459 | Ga0268288 |
| Sample Name | Soil microbial communities from Anza Borrego Desert, Southern California, United States - Bradyrhizobium sp. S3-V5C |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 21570657 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | desert biome → desert → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | USA: California |
| Coordinates | Lat. (o) | 33.305 | Long. (o) | -116.2548 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F022481 | Metagenome / Metatranscriptome | 214 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0268288_10161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4840 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0268288_10161 | Ga0268288_101617 | F022481 | MTPGRTTRFKNATEPFFARFFIDFIPGLAAEFAFTEGSTRVIMSLSAALWMDRKQIDGWRFQHGCSTGRHALRLSFWQLGHLSA |
