NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028231

3300028231: Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028231 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133460 | Gp0293456 | Ga0255263
Sample NameMetatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6315438
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriverriver water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039170Metagenome / Metatranscriptome164Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0255263_102637Not Available599Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0255263_102637Ga0255263_1026371F039170DNAHFDIQPHTYWGEIVLVQHKRMGGGDIEVQTATVPWFHNSWSESQHHHGGPKGNTGLAIAAWGNVIVFYARNHLGSYFLNGNQVTWHNHGWTTIAQGIQCARSGPHFNFLIDKGTGYLRIWGNMHGSNNMDIYGHASGSWATGKSLTGAWADWNGDAGNDQAIINQLNAQGKLSVLGTPRSYFKNKTPRTSTNGQFM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.