x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300028094
3300028094: Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S36 (Metagenome Metatranscriptome)
Overview
Basic Information
IMG/M Taxon OID 3300028094 Open in IMG/M GOLD Reference Gs0132855 | Gp0291467 | Ga0247509 Sample Name Metatranscriptome of enriched cultures of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S36 (Metagenome Metatranscriptome) Sequencing Status Permanent Draft Sequencing Center DOE Joint Genome Institute (JGI) Published? N Use Policy Open
Dataset Contents
Total Genome Size 52297171 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes 1 All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa Type Engineered Taxonomy Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium → Enriched Cultures Of Pce-Dechlorinating Microbial Communities From Ithaca, New York, Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) na → na → na
Location Information
Location USA: New York Coordinates Lat. (o ) 42.4447 Long. (o ) -76.485 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F031111 Metagenome / Metatranscriptome 183 N F055836 Metagenome / Metatranscriptome 138 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0247509_102465 All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes 3196 Open in IMG/M Ga0247509_113670 All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 933 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0247509_102465 Ga0247509_1024651 F031111 NKTRRKKEKSRFLIGKKRCISNIPQNSYYQTIVNIPAAYNFCCYYPQNLPSSQIGKQVKKILKPLNLALIKLSKPKLTFP Ga0247509_113670 Ga0247509_1136701 F055836 MESCEGEVVAIYRKKWSRQFLGFVAVTLRWPMLLLLTLGRFLKINCIFTVYPGSQRDVDGYFPKGLKWFLKPAASGKPFVAGVITTGNGLGRGLVLAVPNTVDQFKKDRDLVGTIMKNLKLTRTLTGAKTIAVAGQGPRFFKSHFPYEQPFVYGLKGRVFSVVETVEQVAATNGLTRSETTVAILGVGEIGAAIIANLKEKGYRAVGIDIRIAEGRVEIGREGMETLRKADLIVVQTPRGDDVVPYYENLKKTAILIDDAHPRITVRPGEVKFYKVAIGRSGVEFKP
