NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028059

3300028059: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-W_D



Overview

Basic Information
IMG/M Taxon OID3300028059 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133410 | Gp0290885 | Ga0247715
Sample NameSoil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-W_D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9576239
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomehillsoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Arizona
CoordinatesLat. (o)32.5789Long. (o)-110.8512Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013474Metagenome / Metatranscriptome271Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247715_103180Not Available544Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247715_103180Ga0247715_1031802F013474LVSFMAAAGITCSQRLGDIIATLEVCDEQRAVALLGAAP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.