| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300028034 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118431 | Gp0290891 | Ga0247721 |
| Sample Name | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_2017_08_16 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 40946510 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → gas well → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | N/A | Depth (m) | 2281 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087432 | Metagenome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0247721_100309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium | 17389 | Open in IMG/M |
| Ga0247721_109831 | Not Available | 654 | Open in IMG/M |
| Ga0247721_110815 | Not Available | 586 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0247721_100309 | Ga0247721_10030916 | F087432 | MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDHLTNLNFKEIIFSAEQDARLQEISELSIPQGFQAQVREYVENGNFPDGYEHPLSDLKLKKERLQHQNDIDEAYQMILESEGLI |
| Ga0247721_109831 | Ga0247721_1098313 | F087432 | VINLIIYENGEYTPCTYRVTLQNRGVEETHYANFRTYWEDMVAKHDHLTNLNFEEIIFSAEQDARLQEISELNIPQGFQAEVKEYVENGNFPEGLNNPLAGLKYKKEMNDAYKMILESEGLI |
| Ga0247721_110815 | Ga0247721_1108152 | F087432 | LIIYENGEYTPCTYRVTLQNKGVEETHYANFRTYWEDMVAKHDHLTNLNFTEITMTAEQQSRFEEIKNENIPQGFQAEVKEYVENGNFPEGLNNPLAGLKYKKEMNDAYKMILESEGLI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |