NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027998

3300027998: Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-E_D



Overview

Basic Information
IMG/M Taxon OID3300027998 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133410 | Gp0290879 | Ga0247709
Sample NameSoil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-2-E_D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21893344
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Hillslopes Of Landscape Evolution Observatory, University Of Arizona, Oracle, Az, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomehillsoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Arizona
CoordinatesLat. (o)32.5788Long. (o)-110.8509Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048419Metagenome / Metatranscriptome148Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247709_101524Not Available925Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247709_101524Ga0247709_1015241F048419MLVRCDGGPSASRLVKFPPPLEIPEKSGLYVLVDDGPVEDWFYVFVPRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.