NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027928

3300027928: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027928 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114675 | Gp0119849 | Ga0208663
Sample NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size13645902
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zoneoil field production water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015582Metagenome / Metatranscriptome253Y
F060849Metagenome132N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208663_102804Not Available706Open in IMG/M
Ga0208663_102832Not Available698Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208663_102804Ga0208663_1028042F060849MNNTFPTLKEIQDVRVSRAPLTVDQMVKRIGDTVRLNYKNPELYSVTVNFPEFGHNSTNGHHFSDMFNDVIRKIPNHYECYWSWMSSDLTFYIKW
Ga0208663_102832Ga0208663_1028322F015582MPDIDPELQAEQLEDAKYLEELNHYVNTLSAPSAESVALYRAKLSMLEDIHTEIRAKYPDFKPVYDALSDPEYNQSLGKYQETTYSFSSRDLRSSNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.