| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027452 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072120 | Ga0207572 |
| Sample Name | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K1-12 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7011320 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.4 | Long. (o) | -85.37 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015371 | Metagenome / Metatranscriptome | 255 | Y |
| F059765 | Metagenome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0207572_100775 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| Ga0207572_100934 | Not Available | 522 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0207572_100775 | Ga0207572_1007752 | F015371 | PILSNEGRQVIAIRNNNSLSDAQKIQEVKSLQRQSDPQLKAILSSAQYDNLKVVRYQAVRWVTQKRLGWQ |
| Ga0207572_100934 | Ga0207572_1009342 | F059765 | MDTDELKIRLRRILAAEEGDGHVDWSKVDCLSKELLGELQMPVPLIVDEYLRGSDRRRQDMVFGHAQRGQLLQFLRSNGISML |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |