NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027441

3300027441: Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K4-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027441 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072114 | Ga0207621
Sample NameSoil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K4-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size11226185
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.4Long. (o)-85.37Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065752Metagenome / Metatranscriptome127Y
F095664Metagenome / Metatranscriptome105N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207621_100874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207621_100006Ga0207621_1000061F095664MPFDRRHVLAQWGGTLPGGEIWSNSLRLASTDTGPDADVPDHDAMVEWLTTYAKDAVAAWHSDFGLKCSSAAKLTYLKMNVVDIQGHYVELNTLEHLYSPVVSGSSASSPHPTQISLAVSLTTEFSRGTAHRGRFYVPMPVHQVDPVSGLISVPDALQVATAAKTFIEALADEPGPDFVVGMRVCVMSQRGTGATNVVTGVDVGRALDTQQRRRNSLKEMYEHVSVDQGAT
Ga0207621_100874Ga0207621_1008741F065752KIAGVDPRGIKLDLYAGKKAGPAPNAVSGGTGKRITRSPKLPASGKYSIARPNVKFATFFQTRFENYTTDCTGPSPSGQPIPCREERIAAITSNQIKVLKPKPKKKHR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.