Basic Information | |
---|---|
IMG/M Taxon OID | 3300027426 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072047 | Ga0207615 |
Sample Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-10 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 12490882 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Wisconsin, United States | |||||||
Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022455 | Metagenome / Metatranscriptome | 214 | Y |
F071393 | Metagenome | 122 | N |
F080568 | Metagenome / Metatranscriptome | 115 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207615_100030 | Not Available | 1101 | Open in IMG/M |
Ga0207615_101307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 515 | Open in IMG/M |
Ga0207615_101487 | Not Available | 500 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207615_100030 | Ga0207615_1000301 | F080568 | SNRYHFNGGLPPDSAHWTTLSDAIVTAEKAIYFAPQIVHTYGYAAGSEVPIFSKAYTTAGTLALGTQERCPGDCAGLIRYATTARTSKNHPVYLFNYYHGVVAVGASFDDVGAVQASAYSTYAGLWIAGFSDGATTYNRAGPNGASAVGSLVEPYITHRDLPR |
Ga0207615_101307 | Ga0207615_1013071 | F022455 | ASSPKSFSFFRGCPNNDGASYANNSRVKVVVRDANGNGIPGVSASDICLLFNGGTPIQGFSGVGADSVVANNQYSVGAVCPDVRCVNADDQSDASGVAYITFTGSVPGTPGVGQRNTGRKWGHYDTEIPVYVLGFKIQGRLTTASANGSYALQIKSFDVVGGTTAALNQGE |
Ga0207615_101487 | Ga0207615_1014871 | F071393 | SEKAALQAQLDGAFEESKTLADRVLAAEAAAKRREENIASSLKQIDFLNAELMAASSERFKVVAAMQGEQRRQRSAFNQQKSMLEIRLQEKEALAATQAATIKQLEGVRDELDKRFRVIEALLTSEREAAERKTRRTADGPPAAAG |
⦗Top⦘ |