NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027415

3300027415: Polar desert microbial communities from Antarctic Dry Valleys - UQ313 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027415 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053075 | Gp0060309 | Ga0207953
Sample NamePolar desert microbial communities from Antarctic Dry Valleys - UQ313 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20219283
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePolar Desert Microbial Communities From Antarctic Dry Valleys
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Alternative Ecosystem Assignments
Environment Ontology (ENVO)polar desert biomedesertice
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationAntarctic Dry Valleys
CoordinatesLat. (o)-78.0544Long. (o)164.0209Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207953_10249All Organisms → cellular organisms → Bacteria1121Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207953_10249Ga0207953_102491F077438EEFSVTSLCCVYSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.