| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300027414 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053075 | Gp0060306 | Ga0208493 |
| Sample Name | Polar desert microbial communities from Antarctic Dry Valleys - UQ493 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 20692400 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | polar desert biome → desert → ice |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Antarctic Dry Valleys | |||||||
| Coordinates | Lat. (o) | -78.0836 | Long. (o) | 164.2839 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208493_10409 | Not Available | 562 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208493_10409 | Ga0208493_104091 | F077438 | YSTHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |