NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027327

3300027327: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027327 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0099546 | Gp0055081 | Ga0209543
Sample NameHost-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size328133411
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationGulf of Piran, Adriatic Sea
CoordinatesLat. (o)45.5099Long. (o)13.56Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004237Metagenome / Metatranscriptome447Y
F011880Metagenome / Metatranscriptome286Y
F045445Metagenome / Metatranscriptome153Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209543_1001060All Organisms → cellular organisms → Bacteria → Proteobacteria28262Open in IMG/M
Ga0209543_1001480All Organisms → cellular organisms → Bacteria20877Open in IMG/M
Ga0209543_1003423All Organisms → cellular organisms → Bacteria10037Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209543_1001060Ga0209543_10010604F004237MIDYDIADMMDGVKNMIEASDIRPGDQVLLLADRRSDSASMEAISAGLKFMGAEPMSLITEPISRYGRVPQAVLDAMHACDVVIWVWPVFITFTPGHRALGRKREESGTQLKEQRMKPYFIYFEGTPGLLARDYARFPNPVLWKLAEKVREVVAAGKVVRIEDDLGSHLTATYDGTRLYGMQFRAGDPPGRCHFPWGRCGVFNGGGKADGEVYLSCVQGVAGELPAPMKWVVKDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIQHGIADPMHWELISKMPWVGLGTDRKNPDFRHVDGSVMNARLYIDERLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHNAHGSGTLW
Ga0209543_1001480Ga0209543_100148019F011880MATKEQIEAAEKRVYSQKDIGEFMTTWKDFPRPGLAAWSERKKAGLMNTARSTRYTPKFRPFDMLSVPNQSLVFLENENHRIGAESVVGVQDAFHRYVDCDMVYFQFCGNTTVETEFGVYEMTPGEVMLVPGGISHRSIGRNDSLRYFCLNREAVDYVLDEEKYTSHQSFVVKRHGGPNWSGLEAPNEEVRGRVTEKMHFWDDGPDDLTVVERDYDSLVGVSTLKPKQQESGIRKLRAFDHFTMVLGKAGGEAGLLALMESQSMRVRTYNMQDEQFAFHRALQSEEVRIQFRGDALDLSEFENVAVSPGEITIIPLGISHSVISVPPDSEDFLRLNFYSKLRWHVPIDPTRHVYNSTFTVETTVHKEADWWKTAANA
Ga0209543_1003423Ga0209543_10034231F045445WPVLHLRNLARRGENDKAAEVIADIMTASQGKPVPGEGFKRPAEYADYCKVGPTRVPFLNFPDNQIERAKKRAAHWMEMNQRYRPLVEAENGRSAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.