NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027272

3300027272: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0939-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300027272 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296237 | Ga0256788
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0939-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size244487512
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available4

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028371Metagenome / Metatranscriptome191Y
F034190Metagenome / Metatranscriptome175Y
F034478Metagenome / Metatranscriptome174Y
F071833Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256788_1056625Not Available1004Open in IMG/M
Ga0256788_1057876Not Available991Open in IMG/M
Ga0256788_1067311Not Available900Open in IMG/M
Ga0256788_1111002Not Available644Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256788_1056625Ga0256788_10566251F034478RVLYSSKMEIEQNTLHRNRPTILRKVVLYGQPQEGKNSFDHREEAEPVGNFLSQCRIDSISLWFLRTDNQNVALQGICSSYKKLNEDNFFESFESVDDKIKNSDRDYDIVHFDDGEYIKAINITEASANGKIGAIEFVTTNKGRKVLAYGSANANAEEGKQAEPLPPGETKTFDFLKSEGENFPGYVVGFFGQYDENHITYLGVYVAPLTEVNYYARRAYILTYKKLQQDKNLINDIAKKLGVEKEGERFKDANLEDADNNSSRIFLYFLDASLNHPELFKAVLEYL
Ga0256788_1057876Ga0256788_10578762F034190HPCPICIVGKKNLLHSSRHRTAGDRFSLHPSAAALLTIPPERIVPTPLHLFLGISNRIILDVFSELLGKDLVEETLKQATTIHSAGCGGQSDQHDLNGPEIRKWLKKDCCSTLLAAAAARNGSIAAATRATFSILQRWLQQLHDHLLHKDDWEPEDIEAWRAAVDDIWQNWTAETSQDAFPKLHMLRHSLEFAERHRFLGRASEAQIESFHYEFKRLYHQQHLNMAHNEPERQRRCLADVALRAVQPFLER
Ga0256788_1067311Ga0256788_10673111F028371VVVDESFLVSASEDGLDVSGLLDFSSTFNDLLLGEFNTVVLEVPLSERSSIDLDDTALDQSVGSDEFVVGGVVDDTDDLGLSGDLFRSPGEVSGVESEGLEFVVSSSNSVSSDGLFTDLGESGRTTRFVLLLLLVDGHTTTGKSSLVSRVSGDTHYV
Ga0256788_1111002Ga0256788_11110021F071833INIKQSNQKTMNLSSDYTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAIDDPEIQACRKEENERFANELKDTFSQL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.