NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026980

3300026980: Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P1 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026980 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053056 | Gp0054741 | Ga0207829
Sample NameAerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P1 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size114973586
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnvironmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBioluminescent Bay, La Paraguera, Puerto Rico
CoordinatesLat. (o)17.967317Long. (o)-67.018833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015419Metagenome / Metatranscriptome255Y
F033243Metagenome178Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207829_100045All Organisms → cellular organisms → Bacteria276998Open in IMG/M
Ga0207829_100103All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria137929Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207829_100045Ga0207829_10004591F015419MNLIINHKLNMKLELKITDEQGNEHLYNVVRSSDGEPNNLNDFILDALQISEDKRKLPFIITTPNGSEYYPLIKMKYENYGSSILGDKLEALIVRW
Ga0207829_100103Ga0207829_10010325F033243MKRKHHDTLGLLKQGPIDLVGHGAEPVLAAGYSTLELERAGLTVEKARELGIPVDAGRCSGVGANVMQLRALLTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.