NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026937

3300026937: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026937 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0055682 | Ga0207466
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20532918
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004397Metagenome / Metatranscriptome440Y
F015863Metagenome / Metatranscriptome251Y
F022740Metagenome / Metatranscriptome213Y
F037925Metagenome / Metatranscriptome167N
F048397Metagenome / Metatranscriptome148N
F085355Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207466_100348Not Available1075Open in IMG/M
Ga0207466_100364All Organisms → cellular organisms → Bacteria1068Open in IMG/M
Ga0207466_100937Not Available817Open in IMG/M
Ga0207466_101487All Organisms → cellular organisms → Archaea700Open in IMG/M
Ga0207466_102186All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae621Open in IMG/M
Ga0207466_102538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales591Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207466_100348Ga0207466_1003482F015863MRRFIPLLILLGLVFGASYASALINRVMGPWSSTAIHQDGSLSHMQFGVDLPRPEWVPVYPGAWVVGGSKITSVEHPAGFHGLDLGTRASLDEVKRFYTEQLTAEGFEVSDLGLMGLNPPTAALLGIDGMLSAKRPSTDDTIDVQIRTPDGIIPSRLLQIHWRKISATPG
Ga0207466_100364Ga0207466_1003641F022740ENTVIFVDKAAGAGSRNVGFYHRRRAQILAARSNELGGLVSFISVGGQPVNTTRNGTIVAAFTFDDIVWTDIQQKTFAAATAQIRQIRPGSTPVLAATGTITPLADTEIKKLGWKIVQLKPDR
Ga0207466_100937Ga0207466_1009371F004397SGGKAAMSEFDLKVALIIFVTKFIDPFAAVPALVAGYFCRTWWQVVIAAAAVGIFVEMILVLFEPTPGVHQGRLLMAVLAAGVWSNLAFAFKTWRAKRA
Ga0207466_101487Ga0207466_1014871F037925MKIIAWCYNCQQQISFNNVSRNRNGVATPVDDHGNLHSCKHKNRKLGFQSQKCFRCGQGIHFDKNCRSISGKYIPLDWNLGKRHDCNKTPDLEV
Ga0207466_102186Ga0207466_1021861F048397VHNSTIFRAILEKNKCDKCNLTIHPNFIGNHKCDHQNCPICKNPITPSQYWPHIRSHPGHENDSPPLPKRNMFENRKN
Ga0207466_102538Ga0207466_1025382F085355MDSLRAALTWIKDLLNWLPEPVVALLILGIAVLLALALHRWAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.