NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026897

3300026897: Cyanobacterial communities from the Joint Genome Institute, California, USA from Joint Genome Institute, California, USA - FECB-24 metaG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026897 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110132 | Gp0095972 | Ga0209906
Sample NameCyanobacterial communities from the Joint Genome Institute, California, USA from Joint Genome Institute, California, USA - FECB-24 metaG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size97118964
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCyanobacterial Communities From The Joint Genome Institute, California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springmicrobial mat material
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationUSA: California
CoordinatesLat. (o)37.9313884Long. (o)-122.0239394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002233Metagenome / Metatranscriptome580Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209906_109877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1304Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209906_109877Ga0209906_1098772F002233MRKVNSFLRSASSRIGRRLKLIVAIAAASLPSAGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.