NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026808

3300026808: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026808 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0056002 | Ga0207581
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A1-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25037330
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.2958Long. (o)-89.3799Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014308Metagenome / Metatranscriptome264Y
F022556Metagenome214Y
F033870Metagenome / Metatranscriptome176Y
F089577Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207581_100520All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales733Open in IMG/M
Ga0207581_102144All Organisms → cellular organisms → Bacteria547Open in IMG/M
Ga0207581_102940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium509Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207581_100520Ga0207581_1005201F033870MNVSMEAPRTPQHDLVAMTAALRGVLLQRVEQGISSSGLTNYFMYIVAKRLMFAGPQTSSSLSEQLRQNPQIIGENLRLMLEQQMVQQEGETWAITDAGRKAMTAANDSGGQVLEDIRGAIGASACDQLV
Ga0207581_102144Ga0207581_1021442F022556DRELTTASSHACAQGKDLWTLITNDIDHEKIHTGQILEARYESRITASRMQRLLAEWLEERARLIGSLIGLTDEQFNRETVPGEWTYRVVAKHVLSRAGLVETIAADQASRMEAP
Ga0207581_102747Ga0207581_1027472F014308MTFMSGSTIGIQLIMPKTGTSPKAKPEQQASEREAATQPVVKAPPPP
Ga0207581_102940Ga0207581_1029402F089577LVIQGGADPLLVSHGDESGPKKLRFSAEDDYQRRHGHGTAVWLSAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.