| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300026678 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0054520 | Ga0208711 |
| Sample Name | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN620 (SPAdes) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3605433 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | grassland biome → land → fertilized soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gorham, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.05 | Long. (o) | -99.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003951 | Metagenome / Metatranscriptome | 460 | Y |
| F009289 | Metagenome / Metatranscriptome | 320 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0208711_100114 | Not Available | 924 | Open in IMG/M |
| Ga0208711_100663 | Not Available | 523 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0208711_100114 | Ga0208711_1001141 | F009289 | MSEPQPADELSPTDRELLRRAELALTQLNNRHGLETDQSATLTAIRLRLEGKSRASLDDLLVAGRDLGDKDPLSEAMTRRQQGPSFDDLVAGAERKPKKSLDDLL |
| Ga0208711_100663 | Ga0208711_1006632 | F003951 | MGTDDSSTATPTLQREVCDKCGSRMELESSAYGFERWKCPKCQQIVGIDRDPEVGSRFQIARGQPWNYSPDAFKN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |