Basic Information | |
---|---|
IMG/M Taxon OID | 3300026678 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0054520 | Ga0208711 |
Sample Name | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN620 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3605433 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | grassland biome → land → fertilized soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gorham, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.05 | Long. (o) | -99.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003951 | Metagenome / Metatranscriptome | 460 | Y |
F009289 | Metagenome / Metatranscriptome | 320 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208711_100114 | Not Available | 924 | Open in IMG/M |
Ga0208711_100663 | Not Available | 523 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208711_100114 | Ga0208711_1001141 | F009289 | MSEPQPADELSPTDRELLRRAELALTQLNNRHGLETDQSATLTAIRLRLEGKSRASLDDLLVAGRDLGDKDPLSEAMTRRQQGPSFDDLVAGAERKPKKSLDDLL |
Ga0208711_100663 | Ga0208711_1006632 | F003951 | MGTDDSSTATPTLQREVCDKCGSRMELESSAYGFERWKCPKCQQIVGIDRDPEVGSRFQIARGQPWNYSPDAFKN |
⦗Top⦘ |