Basic Information | |
---|---|
IMG/M Taxon OID | 3300026671 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053063 | Gp0054408 | Ga0208580 |
Sample Name | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized - NN603 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 6609742 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | grassland biome → land → fertilized soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gorham, Kansas, USA | |||||||
Coordinates | Lat. (o) | 39.05 | Long. (o) | -99.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024497 | Metagenome / Metatranscriptome | 205 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0208580_100089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 967 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0208580_100089 | Ga0208580_1000892 | F024497 | MTRRPRPSQNTEEAHAAMARVFGVDVEAEVAPSSASAPEPPAEESEGRAALGRVFGTEA |
⦗Top⦘ |