Sample 3300026659

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300026659

3300026659: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A3-12 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300026659 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0095510 \| Gp0072089 \| Ga0207619
Sample Name	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A3-12 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	6882545
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Wisconsin, United States
Coordinates	Lat. (^o)	43.3	Long. (^o)	-89.38	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022740	Metagenome / Metatranscriptome	213	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0207619_100030	Ga0207619_1000302	F022740	AARSNELGGLVAFISVGGQPVNTTRNGTIVAAFTFDDIVWTDIQQKTFAAATAQIRQIRPGSTPVLAATGTITPLADTEIRKLGWKIVQLKPER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.