NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026637

3300026637: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1109 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026637 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053063 | Gp0054849 | Ga0208215
Sample NameGrasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1109 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2789024
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments
Environment Ontology (ENVO)grassland biomelandfertilized soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationNunn, Colorado, USA
CoordinatesLat. (o)40.81667Long. (o)-104.76667Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035119Metagenome / Metatranscriptome173Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208215_10033All Organisms → cellular organisms → Bacteria1094Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208215_10033Ga0208215_100332F035119MAYDIDPDQSTSIVAIFLFIDAAFLGFPVLSTMLNGGAFPVVALVLVAGLIAAGVGLLQGRRWGWYLAMVVVGLSVLLDLLRGNLLALVIDALIIFLLTRPATRAKFGVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.